Lsi06G012830 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTTCATTATCAGACTTTTACCATGTCATGACAGCCGTCGTGCCGCTCTACGTTGCCATGATATTAGCTTACGGTTCTGTCAAATGGTGGAAGATTTTTACCCCCGATCAATGCTCCGGTATCAACCGTTTCGTTGCCCTCTTCGCCGTTCCCCTTCTCTCGTTCCACTTCATCGCCTCCAACAATCCCTACACTATGAACTTTCGGTTCATTGCCGCTGATACCCTCCAGAAAATCATTGTCTTGGTGGTGCTCGGCATCTGGACAAAGGTAATATTAAAACTACCACTAAGCTCAAAAGTTTAA ATGATTTCATTATCAGACTTTTACCATGTCATGACAGCCGTCGTGCCGCTCTACGTTGCCATGATATTAGCTTACGGTTCTGTCAAATGGTGGAAGATTTTTACCCCCGATCAATGCTCCGGTATCAACCGTTTCGTTGCCCTCTTCGCCGTTCCCCTTCTCTCGTTCCACTTCATCGCCTCCAACAATCCCTACACTATGAACTTTCGGTTCATTGCCGCTGATACCCTCCAGAAAATCATTGTCTTGGTGGTGCTCGGCATCTGGACAAAGGTAATATTAAAACTACCACTAAGCTCAAAAGTTTAA ATGATTTCATTATCAGACTTTTACCATGTCATGACAGCCGTCGTGCCGCTCTACGTTGCCATGATATTAGCTTACGGTTCTGTCAAATGGTGGAAGATTTTTACCCCCGATCAATGCTCCGGTATCAACCGTTTCGTTGCCCTCTTCGCCGTTCCCCTTCTCTCGTTCCACTTCATCGCCTCCAACAATCCCTACACTATGAACTTTCGGTTCATTGCCGCTGATACCCTCCAGAAAATCATTGTCTTGGTGGTGCTCGGCATCTGGACAAAGGTAATATTAAAACTACCACTAAGCTCAAAAGTTTAA MISLSDFYHVMTAVVPLYVAMILAYGSVKWWKIFTPDQCSGINRFVALFAVPLLSFHFIASNNPYTMNFRFIAADTLQKIIVLVVLGIWTKVILKLPLSSKV
BLAST of Lsi06G012830 vs. Swiss-Prot
Match: PIN1C_ORYSJ (Probable auxin efflux carrier component 1c OS=Oryza sativa subsp. japonica GN=PIN1C PE=2 SV=1) HSP 1 Score: 161.0 bits (406), Expect = 6.9e-39 Identity = 76/90 (84.44%), Postives = 86/90 (95.56%), Query Frame = 1
BLAST of Lsi06G012830 vs. Swiss-Prot
Match: PINI_ARATH (Auxin efflux carrier component 1 OS=Arabidopsis thaliana GN=PIN1 PE=1 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 9.0e-39 Identity = 76/92 (82.61%), Postives = 86/92 (93.48%), Query Frame = 1
BLAST of Lsi06G012830 vs. Swiss-Prot
Match: PIN1_ORYSJ (Auxin efflux carrier component 1 OS=Oryza sativa subsp. japonica GN=PIN1 PE=2 SV=1) HSP 1 Score: 159.8 bits (403), Expect = 1.5e-38 Identity = 75/90 (83.33%), Postives = 85/90 (94.44%), Query Frame = 1
BLAST of Lsi06G012830 vs. Swiss-Prot
Match: PIN4_ARATH (Auxin efflux carrier component 4 OS=Arabidopsis thaliana GN=PIN4 PE=1 SV=1) HSP 1 Score: 151.8 bits (382), Expect = 4.2e-36 Identity = 71/92 (77.17%), Postives = 84/92 (91.30%), Query Frame = 1
BLAST of Lsi06G012830 vs. Swiss-Prot
Match: PIN7_ARATH (Auxin efflux carrier component 7 OS=Arabidopsis thaliana GN=PIN7 PE=1 SV=2) HSP 1 Score: 149.8 bits (377), Expect = 1.6e-35 Identity = 71/89 (79.78%), Postives = 81/89 (91.01%), Query Frame = 1
BLAST of Lsi06G012830 vs. TrEMBL
Match: A0A0A0LPQ3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G025070 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.6e-42 Identity = 89/92 (96.74%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. TrEMBL
Match: D7URM3_CUCSA (Auxin efflux facilitator OS=Cucumis sativus GN=CsPIN3 PE=2 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 1.6e-42 Identity = 89/92 (96.74%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. TrEMBL
Match: A0A0D2Q3Z4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G290000 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 6.1e-42 Identity = 87/92 (94.57%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. TrEMBL
Match: A0A0D2RPG8_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G290000 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 6.1e-42 Identity = 87/92 (94.57%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. TrEMBL
Match: A0A125RLI2_GOSHI (PIN-formed protein 1d OS=Gossypium hirsutum GN=PIN1d PE=2 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 6.1e-42 Identity = 87/92 (94.57%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. TAIR10
Match: AT1G73590.1 (AT1G73590.1 Auxin efflux carrier family protein) HSP 1 Score: 160.6 bits (405), Expect = 5.1e-40 Identity = 76/92 (82.61%), Postives = 86/92 (93.48%), Query Frame = 1
BLAST of Lsi06G012830 vs. TAIR10
Match: AT2G01420.2 (AT2G01420.2 Auxin efflux carrier family protein) HSP 1 Score: 151.8 bits (382), Expect = 2.4e-37 Identity = 71/92 (77.17%), Postives = 84/92 (91.30%), Query Frame = 1
BLAST of Lsi06G012830 vs. TAIR10
Match: AT1G23080.1 (AT1G23080.1 Auxin efflux carrier family protein) HSP 1 Score: 149.8 bits (377), Expect = 8.9e-37 Identity = 71/89 (79.78%), Postives = 81/89 (91.01%), Query Frame = 1
BLAST of Lsi06G012830 vs. TAIR10
Match: AT1G70940.1 (AT1G70940.1 Auxin efflux carrier family protein) HSP 1 Score: 149.4 bits (376), Expect = 1.2e-36 Identity = 71/89 (79.78%), Postives = 81/89 (91.01%), Query Frame = 1
BLAST of Lsi06G012830 vs. TAIR10
Match: AT5G57090.1 (AT5G57090.1 Auxin efflux carrier family protein) HSP 1 Score: 140.6 bits (353), Expect = 5.4e-34 Identity = 64/89 (71.91%), Postives = 78/89 (87.64%), Query Frame = 1
BLAST of Lsi06G012830 vs. NCBI nr
Match: gi|659106969|ref|XP_008453480.1| (PREDICTED: probable auxin efflux carrier component 1c [Cucumis melo]) HSP 1 Score: 180.3 bits (456), Expect = 1.8e-42 Identity = 89/92 (96.74%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. NCBI nr
Match: gi|700208779|gb|KGN63875.1| (hypothetical protein Csa_1G025070 [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 2.3e-42 Identity = 89/92 (96.74%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. NCBI nr
Match: gi|793427270|ref|NP_001292667.1| (probable auxin efflux carrier component 1c [Cucumis sativus]) HSP 1 Score: 179.9 bits (455), Expect = 2.3e-42 Identity = 89/92 (96.74%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. NCBI nr
Match: gi|985768595|gb|AMD39987.1| (PIN-formed protein 1d [Gossypium hirsutum]) HSP 1 Score: 177.9 bits (450), Expect = 8.7e-42 Identity = 87/92 (94.57%), Postives = 91/92 (98.91%), Query Frame = 1
BLAST of Lsi06G012830 vs. NCBI nr
Match: gi|823215144|ref|XP_012440328.1| (PREDICTED: probable auxin efflux carrier component 1c [Gossypium raimondii]) HSP 1 Score: 177.9 bits (450), Expect = 8.7e-42 Identity = 87/92 (94.57%), Postives = 91/92 (98.91%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |