Lsi06G005920 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTGAGGTAACAAATGCAACAGATTACATTGGTTATGATCCAATAAAAGGAGATATTAGTCCTGGATGTAGTAAAAAGCATCCAGAACTTTGTAAATTAACTCCTGCAAATCCATATCAAAGAGGTTGCAGTGCAATCAATCGTTGCAGAGGAGGAAATGATATTATAGATGGTGTAGAAGAGGTTGCATCCACTAGCCCCGCAATGAGCCCTAATGCAGAACTGCATCTTCATTGA ATGATTGAGGTAACAAATGCAACAGATTACATTGGTTATGATCCAATAAAAGGAGATATTAGTCCTGGATGTAGTAAAAAGCATCCAGAACTTTGTAAATTAACTCCTGCAAATCCATATCAAAGAGGTTGCAGTGCAATCAATCGTTGCAGAGGAGGAAATGATATTATAGATGGTGTAGAAGAGGTTGCATCCACTAGCCCCGCAATGAGCCCTAATGCAGAACTGCATCTTCATTGA ATGATTGAGGTAACAAATGCAACAGATTACATTGGTTATGATCCAATAAAAGGAGATATTAGTCCTGGATGTAGTAAAAAGCATCCAGAACTTTGTAAATTAACTCCTGCAAATCCATATCAAAGAGGTTGCAGTGCAATCAATCGTTGCAGAGGAGGAAATGATATTATAGATGGTGTAGAAGAGGTTGCATCCACTAGCCCCGCAATGAGCCCTAATGCAGAACTGCATCTTCATTGA MIEVTNATDYIGYDPIKGDISPGCSKKHPELCKLTPANPYQRGCSAINRCRGGNDIIDGVEEVASTSPAMSPNAELHLH
BLAST of Lsi06G005920 vs. Swiss-Prot
Match: RLF9_ARATH (Protein RALF-like 9 OS=Arabidopsis thaliana GN=RALFL9 PE=3 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 2.6e-09 Identity = 29/48 (60.42%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of Lsi06G005920 vs. Swiss-Prot
Match: RLF15_ARATH (Protein RALF-like 15 OS=Arabidopsis thaliana GN=RALFL15 PE=3 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 3.5e-06 Identity = 24/46 (52.17%), Postives = 27/46 (58.70%), Query Frame = 1
BLAST of Lsi06G005920 vs. TrEMBL
Match: A0A0A0L8B1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G426350 PE=4 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 8.1e-18 Identity = 48/80 (60.00%), Postives = 57/80 (71.25%), Query Frame = 1
BLAST of Lsi06G005920 vs. TrEMBL
Match: V4UF46_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10018043mg PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.4e-06 Identity = 24/42 (57.14%), Postives = 27/42 (64.29%), Query Frame = 1
BLAST of Lsi06G005920 vs. TrEMBL
Match: A0A067F0E4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g041712mg PE=4 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 5.4e-06 Identity = 24/42 (57.14%), Postives = 27/42 (64.29%), Query Frame = 1
BLAST of Lsi06G005920 vs. TrEMBL
Match: D7KVJ4_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_893358 PE=4 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 7.1e-06 Identity = 26/49 (53.06%), Postives = 30/49 (61.22%), Query Frame = 1
BLAST of Lsi06G005920 vs. TAIR10
Match: AT1G61566.1 (AT1G61566.1 ralf-like 9) HSP 1 Score: 62.4 bits (150), Expect = 1.5e-10 Identity = 29/48 (60.42%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of Lsi06G005920 vs. TAIR10
Match: AT2G22055.1 (AT2G22055.1 RALF-like 15) HSP 1 Score: 52.0 bits (123), Expect = 2.0e-07 Identity = 24/46 (52.17%), Postives = 27/46 (58.70%), Query Frame = 1
BLAST of Lsi06G005920 vs. TAIR10
Match: AT2G32885.1 (AT2G32885.1 Rapid alkalinization factor (RALF) family protein) HSP 1 Score: 50.4 bits (119), Expect = 5.7e-07 Identity = 21/49 (42.86%), Postives = 28/49 (57.14%), Query Frame = 1
BLAST of Lsi06G005920 vs. TAIR10
Match: AT2G34825.1 (AT2G34825.1 RALF-like 20) HSP 1 Score: 48.5 bits (114), Expect = 2.2e-06 Identity = 21/48 (43.75%), Postives = 25/48 (52.08%), Query Frame = 1
BLAST of Lsi06G005920 vs. TAIR10
Match: AT4G11653.1 (AT4G11653.1 RALF-like 29) HSP 1 Score: 48.5 bits (114), Expect = 2.2e-06 Identity = 24/52 (46.15%), Postives = 30/52 (57.69%), Query Frame = 1
BLAST of Lsi06G005920 vs. NCBI nr
Match: gi|700202865|gb|KGN57998.1| (hypothetical protein Csa_3G426350 [Cucumis sativus]) HSP 1 Score: 97.4 bits (241), Expect = 1.2e-17 Identity = 48/80 (60.00%), Postives = 57/80 (71.25%), Query Frame = 1
BLAST of Lsi06G005920 vs. NCBI nr
Match: gi|18407238|ref|NP_564779.1| (protein RALF-like 9 [Arabidopsis thaliana]) HSP 1 Score: 62.4 bits (150), Expect = 4.1e-07 Identity = 29/48 (60.42%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of Lsi06G005920 vs. NCBI nr
Match: gi|21592626|gb|AAM64575.1| (unknown [Arabidopsis thaliana]) HSP 1 Score: 62.4 bits (150), Expect = 4.1e-07 Identity = 29/48 (60.42%), Postives = 31/48 (64.58%), Query Frame = 1
BLAST of Lsi06G005920 vs. NCBI nr
Match: gi|567910725|ref|XP_006447676.1| (hypothetical protein CICLE_v10018043mg [Citrus clementina]) HSP 1 Score: 58.2 bits (139), Expect = 7.8e-06 Identity = 24/42 (57.14%), Postives = 27/42 (64.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|