Lsi06G000410 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGGTAAGAAAAAGCCCCTTCATTAGAAGTTAGAAAGAGTCCTCTAAAGAAGGCTAAAATCTAAACATTGATTCTTTTTTTCGCTAGTTTTTTTGAACCGTATGCATCAAAAGGTGCCCGTACGGTTCTTAAGGGATACAATTTTATCCTAATCAACCGACTTTATCGAGAAAGATTACTTTTTTTAGGCCAAGAGGTTGATAGCGAGATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGGATGATACCAAAGATCTGTATTTATTTATAAACTCTCCCGGTGGATGGGTAATACCCGGAGTAGCTATTTATGATACTATGCAATTTGTGCGACCAGATGTACAGACAATATGCATGGGATTAGCCGCTTCAATGGGATCTTTTATTCTGGTCGGAGGAGAAATTACCAAACGTCTAGCATTCCCTCACGCTCGGCGCCAATGA ATGGAAGGCCAAGAGGTTGATAGCGAGATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGGATGATACCAAAGATCTGTATTTATTTATAAACTCTCCCGGTGGATGGGTAATACCCGGAGTAGCTATTTATGATACTATGCAATTTGTGCGACCAGATGTACAGACAATATGCATGGGATTAGCCGCTTCAATGGGATCTTTTATTCTGGTCGGAGGAGAAATTACCAAACGTCTAGCATTCCCTCACGCTCGGCGCCAATGA ATGGAAGGCCAAGAGGTTGATAGCGAGATCTCGAATCAACTTATTGGTCTTATGGTATATCTCAGTATAGAGGATGATACCAAAGATCTGTATTTATTTATAAACTCTCCCGGTGGATGGGTAATACCCGGAGTAGCTATTTATGATACTATGCAATTTGTGCGACCAGATGTACAGACAATATGCATGGGATTAGCCGCTTCAATGGGATCTTTTATTCTGGTCGGAGGAGAAATTACCAAACGTCTAGCATTCCCTCACGCTCGGCGCCAATGA MEGQEVDSEISNQLIGLMVYLSIEDDTKDLYLFINSPGGWVIPGVAIYDTMQFVRPDVQTICMGLAASMGSFILVGGEITKRLAFPHARRQ
BLAST of Lsi06G000410 vs. Swiss-Prot
Match: CLPP_SPIOL (ATP-dependent Clp protease proteolytic subunit OS=Spinacia oleracea GN=clpP PE=3 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.1e-43 Identity = 86/87 (98.85%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of Lsi06G000410 vs. Swiss-Prot
Match: CLPP_DAUCA (ATP-dependent Clp protease proteolytic subunit OS=Daucus carota GN=clpP PE=3 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.1e-43 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of Lsi06G000410 vs. Swiss-Prot
Match: CLPP_NICTO (ATP-dependent Clp protease proteolytic subunit OS=Nicotiana tomentosiformis GN=clpP PE=3 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.1e-43 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of Lsi06G000410 vs. Swiss-Prot
Match: CLPP_TOBAC (ATP-dependent Clp protease proteolytic subunit OS=Nicotiana tabacum GN=clpP PE=2 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.1e-43 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of Lsi06G000410 vs. Swiss-Prot
Match: CLPP_NICSY (ATP-dependent Clp protease proteolytic subunit OS=Nicotiana sylvestris GN=clpP PE=3 SV=1) HSP 1 Score: 175.3 bits (443), Expect = 3.1e-43 Identity = 85/87 (97.70%), Postives = 86/87 (98.85%), Query Frame = 1
BLAST of Lsi06G000410 vs. TrEMBL
Match: X2F0D4_LAGSI (ATP-dependent Clp protease proteolytic subunit OS=Lagenaria siceraria GN=clpP PE=3 SV=1) HSP 1 Score: 182.6 bits (462), Expect = 2.2e-43 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Lsi06G000410 vs. TrEMBL
Match: A0A120L1B9_GYNPE (ATP-dependent Clp protease proteolytic subunit OS=Gynostemma pentaphyllum GN=clpP PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 3.2e-42 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of Lsi06G000410 vs. TrEMBL
Match: A0A0G2R8L5_MESCR (ATP-dependent Clp protease proteolytic subunit OS=Mesembryanthemum crystallinum GN=clpP PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 3.2e-42 Identity = 87/88 (98.86%), Postives = 87/88 (98.86%), Query Frame = 1
BLAST of Lsi06G000410 vs. TrEMBL
Match: X2F3T1_LAGSI (ATP-dependent Clp protease proteolytic subunit OS=Lagenaria siceraria GN=clpP PE=3 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 4.1e-42 Identity = 87/89 (97.75%), Postives = 87/89 (97.75%), Query Frame = 1
BLAST of Lsi06G000410 vs. TrEMBL
Match: A0A0S2M9W9_9ROSI (ATP-dependent Clp protease proteolytic subunit OS=Juglans regia GN=clpP PE=3 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 5.4e-42 Identity = 87/88 (98.86%), Postives = 87/88 (98.86%), Query Frame = 1
BLAST of Lsi06G000410 vs. TAIR10
Match: ATCG00670.1 (ATCG00670.1 plastid-encoded CLP P) HSP 1 Score: 161.0 bits (406), Expect = 3.5e-40 Identity = 77/87 (88.51%), Postives = 82/87 (94.25%), Query Frame = 1
BLAST of Lsi06G000410 vs. TAIR10
Match: AT1G02560.1 (AT1G02560.1 nuclear encoded CLP protease 5) HSP 1 Score: 97.4 bits (241), Expect = 4.7e-21 Identity = 42/87 (48.28%), Postives = 64/87 (73.56%), Query Frame = 1
BLAST of Lsi06G000410 vs. TAIR10
Match: AT1G12410.1 (AT1G12410.1 CLP protease proteolytic subunit 2) HSP 1 Score: 87.0 bits (214), Expect = 6.3e-18 Identity = 38/87 (43.68%), Postives = 58/87 (66.67%), Query Frame = 1
BLAST of Lsi06G000410 vs. TAIR10
Match: AT1G66670.1 (AT1G66670.1 CLP protease proteolytic subunit 3) HSP 1 Score: 85.1 bits (209), Expect = 2.4e-17 Identity = 38/87 (43.68%), Postives = 57/87 (65.52%), Query Frame = 1
BLAST of Lsi06G000410 vs. TAIR10
Match: AT5G23140.1 (AT5G23140.1 nuclear-encoded CLP protease P7) HSP 1 Score: 81.3 bits (199), Expect = 3.5e-16 Identity = 34/83 (40.96%), Postives = 58/83 (69.88%), Query Frame = 1
BLAST of Lsi06G000410 vs. NCBI nr
Match: gi|595645220|gb|AHM88683.1| (clp protease proteolytic subunit (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 182.6 bits (462), Expect = 3.1e-43 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 1
BLAST of Lsi06G000410 vs. NCBI nr
Match: gi|1002166164|ref|YP_009236304.1| (clp protease proteolytic subunit (chloroplast) [Gynostemma pentaphyllum]) HSP 1 Score: 178.7 bits (452), Expect = 4.5e-42 Identity = 87/87 (100.00%), Postives = 87/87 (100.00%), Query Frame = 1
BLAST of Lsi06G000410 vs. NCBI nr
Match: gi|982898186|ref|YP_009221832.1| (clp protease proteolytic subunit (chloroplast) [Mesembryanthemum crystallinum]) HSP 1 Score: 178.7 bits (452), Expect = 4.5e-42 Identity = 87/88 (98.86%), Postives = 87/88 (98.86%), Query Frame = 1
BLAST of Lsi06G000410 vs. NCBI nr
Match: gi|595645456|gb|AHM88915.1| (clp protease proteolytic subunit (chloroplast) [Lagenaria siceraria]) HSP 1 Score: 178.3 bits (451), Expect = 5.9e-42 Identity = 87/89 (97.75%), Postives = 87/89 (97.75%), Query Frame = 1
BLAST of Lsi06G000410 vs. NCBI nr
Match: gi|959125630|ref|YP_009186193.1| (ATP-dependent Clp protease proteolytic subunit (chloroplast) [Juglans regia]) HSP 1 Score: 177.9 bits (450), Expect = 7.8e-42 Identity = 87/88 (98.86%), Postives = 87/88 (98.86%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |