Lsi06G000400 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATGTGAGATAGAGAAAACCATTTATTAAATCATCAGGGTAATGATCCATCAACCTGCTAGTTCTTTTTATGAGGCACAAACGGGAGAATTTATCCTGGAAGCGGAAGAACTACTGAAGCTGCGCGAAACCATCACAAGGGTTTATGTACAAAGAACAGGCAAACCCTTATGGGTTGTATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGGAATTGTTGATCTTGTAGCGGTTGAATAA ATGATGGTAATGATCCATCAACCTGCTAGTTCTTTTTATGAGGCACAAACGGGAGAATTTATCCTGGAAGCGGAAGAACTACTGAAGCTGCGCGAAACCATCACAAGGGTTTATGTACAAAGAACAGGCAAACCCTTATGGGTTGTATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGGAATTGTTGATCTTGTAGCGGTTGAATAA ATGATGGTAATGATCCATCAACCTGCTAGTTCTTTTTATGAGGCACAAACGGGAGAATTTATCCTGGAAGCGGAAGAACTACTGAAGCTGCGCGAAACCATCACAAGGGTTTATGTACAAAGAACAGGCAAACCCTTATGGGTTGTATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAACAGAAGCCCAAGCTCATGGAATTGTTGATCTTGTAGCGGTTGAATAA MMVMIHQPASSFYEAQTGEFILEAEELLKLRETITRVYVQRTGKPLWVVSEDMERDVFMSATEAQAHGIVDLVAVE
BLAST of Lsi06G000400 vs. Swiss-Prot
Match: CLPP_EUCGG (ATP-dependent Clp protease proteolytic subunit OS=Eucalyptus globulus subsp. globulus GN=clpP PE=3 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 2.2e-34 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. Swiss-Prot
Match: CLPP_OLIPU (ATP-dependent Clp protease proteolytic subunit OS=Olimarabidopsis pumila GN=clpP PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 6.5e-34 Identity = 72/74 (97.30%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. Swiss-Prot
Match: CLPP_AETGR (ATP-dependent Clp protease proteolytic subunit OS=Aethionema grandiflorum GN=clpP PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 6.5e-34 Identity = 72/74 (97.30%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. Swiss-Prot
Match: CLPP_BARVE (ATP-dependent Clp protease proteolytic subunit OS=Barbarea verna GN=clpP PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 6.5e-34 Identity = 72/74 (97.30%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. Swiss-Prot
Match: CLPP_LOBMA (ATP-dependent Clp protease proteolytic subunit OS=Lobularia maritima GN=clpP PE=3 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 6.5e-34 Identity = 72/74 (97.30%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. TrEMBL
Match: D3WEB5_HEUSA (ATP-dependent Clp protease proteolytic subunit OS=Heuchera sanguinea GN=clpP PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 1.9e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. TrEMBL
Match: A0A0N7E515_9MAGN (ATP-dependent Clp protease proteolytic subunit OS=Heuchera parviflora var. saurensis GN=clpP PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 1.9e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. TrEMBL
Match: A0A120L1B9_GYNPE (ATP-dependent Clp protease proteolytic subunit OS=Gynostemma pentaphyllum GN=clpP PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 1.9e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. TrEMBL
Match: T1QPC6_EUCER (ATP-dependent Clp protease proteolytic subunit OS=Eucalyptus erythrocorys GN=clpP PE=3 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 2.5e-32 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. TrEMBL
Match: T1QH83_EUCRA (ATP-dependent Clp protease proteolytic subunit OS=Eucalyptus radiata GN=clpP PE=3 SV=1) HSP 1 Score: 145.6 bits (366), Expect = 2.5e-32 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. TAIR10
Match: ATCG00670.1 (ATCG00670.1 plastid-encoded CLP P) HSP 1 Score: 143.7 bits (361), Expect = 4.8e-35 Identity = 71/74 (95.95%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. TAIR10
Match: AT5G23140.1 (AT5G23140.1 nuclear-encoded CLP protease P7) HSP 1 Score: 60.1 bits (144), Expect = 6.9e-10 Identity = 29/74 (39.19%), Postives = 49/74 (66.22%), Query Frame = 1
BLAST of Lsi06G000400 vs. TAIR10
Match: AT1G02560.1 (AT1G02560.1 nuclear encoded CLP protease 5) HSP 1 Score: 48.1 bits (113), Expect = 2.7e-06 Identity = 24/69 (34.78%), Postives = 40/69 (57.97%), Query Frame = 1
BLAST of Lsi06G000400 vs. NCBI nr
Match: gi|1002166164|ref|YP_009236304.1| (clp protease proteolytic subunit (chloroplast) [Gynostemma pentaphyllum]) HSP 1 Score: 146.0 bits (367), Expect = 2.7e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. NCBI nr
Match: gi|290489466|gb|ADD31117.1| (clp protease proteolytic subunit protein (chloroplast) [Heuchera sanguinea]) HSP 1 Score: 146.0 bits (367), Expect = 2.7e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. NCBI nr
Match: gi|918021112|ref|YP_009163505.1| (clp protease proteolytic subunit (plastid) [Eugenia uniflora]) HSP 1 Score: 145.6 bits (366), Expect = 3.6e-32 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. NCBI nr
Match: gi|545716528|ref|YP_008575393.1| (ATP-dependent Clp protease proteolytic subunit (chloroplast) [Eucalyptus verrucata]) HSP 1 Score: 145.6 bits (366), Expect = 3.6e-32 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Lsi06G000400 vs. NCBI nr
Match: gi|545718420|ref|YP_008577263.1| (ATP-dependent Clp protease proteolytic subunit (chloroplast) [Eucalyptus salmonophloia]) HSP 1 Score: 145.6 bits (366), Expect = 3.6e-32 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |