Lsi04G023670 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTCTGGTATATACGAACAGGATGGAGAATGATATTTTTTTGAAGAAAGAGTTAGATGAGTGGAGTAAGAACGATAAGAGGTTTAAAGTATGGTATGTTGTAAGTGAGAGTGTAAGGGAAGGGTGGGAATTCAGTGGGAGTGATAAGGGAGACTATCATGGGGAACATCTTCCAGAAGATTCGGGGAATACGTTGGCCTTGGCTTATGGACCTCTGTCGATGATTAAGTTTGTTGTGCAACCCAACTTGGAGAAGATGAACTACGACACTACTAATTCGTGGTTGGTGTTTTAG ATGTTTCTGGTATATACGAACAGGATGGAGAATGATATTTTTTTGAAGAAAGAGTTAGATGAGTGGAGTAAGAACGATAAGAGGTTTAAAGTATGGTATGTTGTAAGTGAGAGTGTAAGGGAAGGGTGGGAATTCAGTGGGAGTGATAAGGGAGACTATCATGGGGAACATCTTCCAGAAGATTCGGGGAATACGTTGGCCTTGGCTTATGGACCTCTGTCGATGATTAAGTTTGTTGTGCAACCCAACTTGGAGAAGATGAACTACGACACTACTAATTCGTGGTTGGTGTTTTAG ATGTTTCTGGTATATACGAACAGGATGGAGAATGATATTTTTTTGAAGAAAGAGTTAGATGAGTGGAGTAAGAACGATAAGAGGTTTAAAGTATGGTATGTTGTAAGTGAGAGTGTAAGGGAAGGGTGGGAATTCAGTGGGAGTGATAAGGGAGACTATCATGGGGAACATCTTCCAGAAGATTCGGGGAATACGTTGGCCTTGGCTTATGGACCTCTGTCGATGATTAAGTTTGTTGTGCAACCCAACTTGGAGAAGATGAACTACGACACTACTAATTCGTGGTTGGTGTTTTAG MFLVYTNRMENDIFLKKELDEWSKNDKRFKVWYVVSESVREGWEFSGSDKGDYHGEHLPEDSGNTLALAYGPLSMIKFVVQPNLEKMNYDTTNSWLVF
BLAST of Lsi04G023670 vs. Swiss-Prot
Match: NIA_CUCMA (Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1) HSP 1 Score: 122.9 bits (307), Expect = 2.0e-27 Identity = 60/99 (60.61%), Postives = 75/99 (75.76%), Query Frame = 1
BLAST of Lsi04G023670 vs. Swiss-Prot
Match: NIA1_SOYBN (Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.1e-25 Identity = 58/99 (58.59%), Postives = 70/99 (70.71%), Query Frame = 1
BLAST of Lsi04G023670 vs. Swiss-Prot
Match: NIA2_SOYBN (Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1) HSP 1 Score: 114.8 bits (286), Expect = 5.4e-25 Identity = 57/99 (57.58%), Postives = 69/99 (69.70%), Query Frame = 1
BLAST of Lsi04G023670 vs. Swiss-Prot
Match: NIA_BETPN (Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.6e-24 Identity = 56/99 (56.57%), Postives = 72/99 (72.73%), Query Frame = 1
BLAST of Lsi04G023670 vs. Swiss-Prot
Match: NIA_CICIN (Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 6.0e-24 Identity = 57/100 (57.00%), Postives = 72/100 (72.00%), Query Frame = 1
BLAST of Lsi04G023670 vs. TrEMBL
Match: A0A0A0L1Y7_CUCSA (Nitrate reductase OS=Cucumis sativus GN=Csa_4G377160 PE=3 SV=1) HSP 1 Score: 142.1 bits (357), Expect = 3.5e-31 Identity = 72/99 (72.73%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of Lsi04G023670 vs. TrEMBL
Match: E7BXW7_CUCSA (Nitrate reductase OS=Cucumis sativus PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 7.6e-26 Identity = 61/99 (61.62%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of Lsi04G023670 vs. TrEMBL
Match: E2IZV5_CUCSA (Nitrate reductase OS=Cucumis sativus GN=NR2 PE=2 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 7.6e-26 Identity = 61/99 (61.62%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of Lsi04G023670 vs. TrEMBL
Match: A0A067GZP3_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0027241mg PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.9e-25 Identity = 59/99 (59.60%), Postives = 75/99 (75.76%), Query Frame = 1
BLAST of Lsi04G023670 vs. TrEMBL
Match: V4TCH9_9ROSI (Nitrate reductase OS=Citrus clementina GN=CICLE_v10000220mg PE=3 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 4.9e-25 Identity = 59/99 (59.60%), Postives = 75/99 (75.76%), Query Frame = 1
BLAST of Lsi04G023670 vs. TAIR10
Match: AT1G37130.1 (AT1G37130.1 nitrate reductase 2) HSP 1 Score: 91.7 bits (226), Expect = 2.8e-19 Identity = 49/101 (48.51%), Postives = 66/101 (65.35%), Query Frame = 1
BLAST of Lsi04G023670 vs. TAIR10
Match: AT1G77760.1 (AT1G77760.1 nitrate reductase 1) HSP 1 Score: 90.5 bits (223), Expect = 6.2e-19 Identity = 49/101 (48.51%), Postives = 67/101 (66.34%), Query Frame = 1
BLAST of Lsi04G023670 vs. NCBI nr
Match: gi|659086811|ref|XP_008444121.1| (PREDICTED: nitrate reductase [NADH]) HSP 1 Score: 143.3 bits (360), Expect = 2.3e-31 Identity = 73/99 (73.74%), Postives = 76/99 (76.77%), Query Frame = 1
BLAST of Lsi04G023670 vs. NCBI nr
Match: gi|778689095|ref|XP_011652901.1| (PREDICTED: uncharacterized protein LOC101216001 isoform X1 [Cucumis sativus]) HSP 1 Score: 142.1 bits (357), Expect = 5.1e-31 Identity = 72/99 (72.73%), Postives = 78/99 (78.79%), Query Frame = 1
BLAST of Lsi04G023670 vs. NCBI nr
Match: gi|525507312|ref|NP_001267696.1| (nitrate reductase [NADH]) HSP 1 Score: 124.4 bits (311), Expect = 1.1e-25 Identity = 61/99 (61.62%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of Lsi04G023670 vs. NCBI nr
Match: gi|659120996|ref|XP_008460453.1| (PREDICTED: nitrate reductase [NADH]) HSP 1 Score: 124.4 bits (311), Expect = 1.1e-25 Identity = 61/99 (61.62%), Postives = 74/99 (74.75%), Query Frame = 1
BLAST of Lsi04G023670 vs. NCBI nr
Match: gi|301507714|gb|ADK77877.1| (nitrate reductase [Cucumis sativus]) HSP 1 Score: 124.4 bits (311), Expect = 1.1e-25 Identity = 61/99 (61.62%), Postives = 74/99 (74.75%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |