Lsi04G010220 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGCATGAATGTGCATCAAAATGGTCTTTGGGTGTTGCAAAAACCATTCCTGGGCTTATTGTGAAGGATGTAATTAATCCAGATTCCCATTTGTGGGTTTCGTTGGTGAATGTATATGCAAAGTGCAGGTACTCTTCATATGCTCGATTAGTGCTTGCTAAAATGCCTGATCATGATGTTGTTTCTTGGACGGCATTAATTCAAGGTCTTGTAGCAGAAGGATTTGTTAACGATAGTATTTATTTATTTCAGGAGATGCAAATGAAGGAATCATGCCCAATGAGTTCACTCTAG ATGTTGCATGAATGTGCATCAAAATGGTCTTTGGGTGTTGCAAAAACCATTCCTGGGCTTATTGTGAAGGATGTAATTAATCCAGATTCCCATTTGTGGGTTTCGTTGGTGAATGTATATGCAAAGTGCAGGTACTCTTCATATGCTCGATTAGTGCTTGCTAAAATGCCTGATCATGATGTTGTTTCTTGGACGGCATTAATTCAAGGTCTTGTAGCAGAAGGATTTGTTAACGATAGTATTTATTTATTTCAGGAGATGCAAATGAAGGAATCATGCCCAATGAGTTCACTCTAG ATGTTGCATGAATGTGCATCAAAATGGTCTTTGGGTGTTGCAAAAACCATTCCTGGGCTTATTGTGAAGGATGTAATTAATCCAGATTCCCATTTGTGGGTTTCGTTGGTGAATGTATATGCAAAGTGCAGGTACTCTTCATATGCTCGATTAGTGCTTGCTAAAATGCCTGATCATGATGTTGTTTCTTGGACGGCATTAATTCAAGGTCTTGTAGCAGAAGGATTTGTTAACGATAGTATTTATTTATTTCAGGAGATGCAAATGAAGGAATCATGCCCAATGAGTTCACTCTAG MLHECASKWSLGVAKTIPGLIVKDVINPDSHLWVSLVNVYAKCRYSSYARLVLAKMPDHDVVSWTALIQGLVAEGFVNDSIYLFQEMQMKESCPMSSL
BLAST of Lsi04G010220 vs. Swiss-Prot
Match: PPR32_ARATH (Pentatricopeptide repeat-containing protein At1g11290, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 9.3e-09 Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 1
BLAST of Lsi04G010220 vs. Swiss-Prot
Match: PPR88_ARATH (Pentatricopeptide repeat-containing protein At1g62260, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E10 PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.7e-08 Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 1
BLAST of Lsi04G010220 vs. Swiss-Prot
Match: PP321_ARATH (Pentatricopeptide repeat-containing protein At4g18840 OS=Arabidopsis thaliana GN=PCMP-E101 PE=3 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 2.7e-08 Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 1
BLAST of Lsi04G010220 vs. Swiss-Prot
Match: PPR60_ARATH (Pentatricopeptide repeat-containing protein At1g26900, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E54 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 3.5e-08 Identity = 32/93 (34.41%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of Lsi04G010220 vs. Swiss-Prot
Match: PPR10_ARATH (Pentatricopeptide repeat-containing protein At1g04840 OS=Arabidopsis thaliana GN=PCMP-H64 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.6e-08 Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 1
BLAST of Lsi04G010220 vs. TrEMBL
Match: A0A0A0K4Y9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G388380 PE=4 SV=1) HSP 1 Score: 165.2 bits (417), Expect = 3.9e-38 Identity = 82/94 (87.23%), Postives = 84/94 (89.36%), Query Frame = 1
BLAST of Lsi04G010220 vs. TrEMBL
Match: M5VT93_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa020478mg PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.3e-19 Identity = 50/88 (56.82%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Lsi04G010220 vs. TrEMBL
Match: B9RKB2_RICCO (Pentatricopeptide repeat-containing protein, putative OS=Ricinus communis GN=RCOM_1048080 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 5.3e-19 Identity = 48/94 (51.06%), Postives = 63/94 (67.02%), Query Frame = 1
BLAST of Lsi04G010220 vs. TrEMBL
Match: F6HGR7_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_11s0016g02500 PE=4 SV=1) HSP 1 Score: 99.8 bits (247), Expect = 2.0e-18 Identity = 48/84 (57.14%), Postives = 60/84 (71.43%), Query Frame = 1
BLAST of Lsi04G010220 vs. TrEMBL
Match: U5FHM8_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0018s06910g PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 7.7e-18 Identity = 48/88 (54.55%), Postives = 60/88 (68.18%), Query Frame = 1
BLAST of Lsi04G010220 vs. TAIR10
Match: AT1G11290.1 (AT1G11290.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 5.2e-10 Identity = 30/87 (34.48%), Postives = 45/87 (51.72%), Query Frame = 1
BLAST of Lsi04G010220 vs. TAIR10
Match: AT1G62260.1 (AT1G62260.1 mitochondrial editing factor 9) HSP 1 Score: 59.3 bits (142), Expect = 1.5e-09 Identity = 27/70 (38.57%), Postives = 45/70 (64.29%), Query Frame = 1
BLAST of Lsi04G010220 vs. TAIR10
Match: AT4G18840.1 (AT4G18840.1 Pentatricopeptide repeat (PPR-like) superfamily protein) HSP 1 Score: 59.3 bits (142), Expect = 1.5e-09 Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 1
BLAST of Lsi04G010220 vs. TAIR10
Match: AT1G26900.1 (AT1G26900.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 58.9 bits (141), Expect = 2.0e-09 Identity = 32/93 (34.41%), Postives = 53/93 (56.99%), Query Frame = 1
BLAST of Lsi04G010220 vs. TAIR10
Match: AT1G04840.1 (AT1G04840.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 58.5 bits (140), Expect = 2.6e-09 Identity = 31/94 (32.98%), Postives = 48/94 (51.06%), Query Frame = 1
BLAST of Lsi04G010220 vs. NCBI nr
Match: gi|449458534|ref|XP_004147002.1| (PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 5.6e-38 Identity = 82/94 (87.23%), Postives = 84/94 (89.36%), Query Frame = 1
BLAST of Lsi04G010220 vs. NCBI nr
Match: gi|700189572|gb|KGN44805.1| (hypothetical protein Csa_7G388380 [Cucumis sativus]) HSP 1 Score: 165.2 bits (417), Expect = 5.6e-38 Identity = 82/94 (87.23%), Postives = 84/94 (89.36%), Query Frame = 1
BLAST of Lsi04G010220 vs. NCBI nr
Match: gi|659100922|ref|XP_008451336.1| (PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Cucumis melo]) HSP 1 Score: 163.3 bits (412), Expect = 2.1e-37 Identity = 81/94 (86.17%), Postives = 84/94 (89.36%), Query Frame = 1
BLAST of Lsi04G010220 vs. NCBI nr
Match: gi|659100932|ref|XP_008451342.1| (PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X3 [Cucumis melo]) HSP 1 Score: 163.3 bits (412), Expect = 2.1e-37 Identity = 81/94 (86.17%), Postives = 84/94 (89.36%), Query Frame = 1
BLAST of Lsi04G010220 vs. NCBI nr
Match: gi|659100924|ref|XP_008451337.1| (PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Cucumis melo]) HSP 1 Score: 163.3 bits (412), Expect = 2.1e-37 Identity = 81/94 (86.17%), Postives = 84/94 (89.36%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |