Lsi04G001950 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGACAAGTACGAGAAGGAGAATTTGGCCGCAAAATACCTAGAAGGGAGGCCGAGATCTTACCCCGCCGACTGGTACTCTAAACTCGCCGCTCTCACCGCCGGCCACTCCCTCGCCTGCGACTTCGGCACCGGAAACGGCCAAGCCGCTCTCGGCGTTAGTCTTTTCATCCTTCGAATTGATCTAAATACGCGATCTCCATGA ATGGCGGACAAGTACGAGAAGGAGAATTTGGCCGCAAAATACCTAGAAGGGAGGCCGAGATCTTACCCCGCCGACTGGTACTCTAAACTCGCCGCTCTCACCGCCGGCCACTCCCTCGCCTGCGACTTCGGCACCGGAAACGGCCAAGCCGCTCTCGGCGTTAGTCTTTTCATCCTTCGAATTGATCTAAATACGCGATCTCCATGA ATGGCGGACAAGTACGAGAAGGAGAATTTGGCCGCAAAATACCTAGAAGGGAGGCCGAGATCTTACCCCGCCGACTGGTACTCTAAACTCGCCGCTCTCACCGCCGGCCACTCCCTCGCCTGCGACTTCGGCACCGGAAACGGCCAAGCCGCTCTCGGCGTTAGTCTTTTCATCCTTCGAATTGATCTAAATACGCGATCTCCATGA MADKYEKENLAAKYLEGRPRSYPADWYSKLAALTAGHSLACDFGTGNGQAALGVSLFILRIDLNTRSP
BLAST of Lsi04G001950 vs. TrEMBL
Match: A0A0A0KUM9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G611730 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-21 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of Lsi04G001950 vs. TrEMBL
Match: D7T1I6_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_06s0009g01530 PE=4 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.0e-08 Identity = 35/55 (63.64%), Postives = 42/55 (76.36%), Query Frame = 1
BLAST of Lsi04G001950 vs. TrEMBL
Match: V4JWS9_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10011654mg PE=4 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 6.5e-08 Identity = 31/51 (60.78%), Postives = 37/51 (72.55%), Query Frame = 1
BLAST of Lsi04G001950 vs. TrEMBL
Match: A5BFG4_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_039111 PE=4 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 8.5e-08 Identity = 35/55 (63.64%), Postives = 41/55 (74.55%), Query Frame = 1
BLAST of Lsi04G001950 vs. TrEMBL
Match: V4MF65_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10026009mg PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-07 Identity = 31/48 (64.58%), Postives = 38/48 (79.17%), Query Frame = 1
BLAST of Lsi04G001950 vs. TAIR10
Match: AT4G22530.1 (AT4G22530.1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein) HSP 1 Score: 62.4 bits (150), Expect = 1.3e-10 Identity = 29/42 (69.05%), Postives = 36/42 (85.71%), Query Frame = 1
BLAST of Lsi04G001950 vs. TAIR10
Match: AT1G55450.2 (AT1G55450.2 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 3.6e-10 Identity = 31/52 (59.62%), Postives = 35/52 (67.31%), Query Frame = 1
BLAST of Lsi04G001950 vs. TAIR10
Match: AT3G54150.1 (AT3G54150.1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein) HSP 1 Score: 57.8 bits (138), Expect = 3.1e-09 Identity = 31/54 (57.41%), Postives = 36/54 (66.67%), Query Frame = 1
BLAST of Lsi04G001950 vs. TAIR10
Match: AT5G10830.1 (AT5G10830.1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein) HSP 1 Score: 55.1 bits (131), Expect = 2.0e-08 Identity = 30/55 (54.55%), Postives = 39/55 (70.91%), Query Frame = 1
BLAST of Lsi04G001950 vs. TAIR10
Match: AT3G61210.1 (AT3G61210.1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein) HSP 1 Score: 53.5 bits (127), Expect = 5.8e-08 Identity = 25/51 (49.02%), Postives = 34/51 (66.67%), Query Frame = 1
BLAST of Lsi04G001950 vs. NCBI nr
Match: gi|449434550|ref|XP_004135059.1| (PREDICTED: putative methyltransferase DDB_G0268948 [Cucumis sativus]) HSP 1 Score: 110.2 bits (274), Expect = 1.5e-21 Identity = 51/55 (92.73%), Postives = 54/55 (98.18%), Query Frame = 1
BLAST of Lsi04G001950 vs. NCBI nr
Match: gi|659091729|ref|XP_008446700.1| (PREDICTED: putative methyltransferase DDB_G0268948 [Cucumis melo]) HSP 1 Score: 109.8 bits (273), Expect = 1.9e-21 Identity = 51/55 (92.73%), Postives = 53/55 (96.36%), Query Frame = 1
BLAST of Lsi04G001950 vs. NCBI nr
Match: gi|225436027|ref|XP_002274567.1| (PREDICTED: putative methyltransferase DDB_G0268948 [Vitis vinifera]) HSP 1 Score: 64.7 bits (156), Expect = 7.1e-08 Identity = 35/55 (63.64%), Postives = 42/55 (76.36%), Query Frame = 1
BLAST of Lsi04G001950 vs. NCBI nr
Match: gi|470127578|ref|XP_004299745.1| (PREDICTED: putative methyltransferase DDB_G0268948 [Fragaria vesca subsp. vesca]) HSP 1 Score: 64.7 bits (156), Expect = 7.1e-08 Identity = 35/55 (63.64%), Postives = 42/55 (76.36%), Query Frame = 1
BLAST of Lsi04G001950 vs. NCBI nr
Match: gi|743934139|ref|XP_011011392.1| (PREDICTED: uncharacterized protein LOC105115977 isoform X1 [Populus euphratica]) HSP 1 Score: 64.7 bits (156), Expect = 7.1e-08 Identity = 34/55 (61.82%), Postives = 43/55 (78.18%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|