Lsi03G021550 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGAAGGATCGGAAGATCGGAGTTGCTCTGGATTTCTCCAACAGTAGCAAAAATGCTCTCAAATGGGCCATCGACAACTTAGCCGACAAGGGCGACACTCTCTTCATCATCTATGTTAACACCAACTCACTCAACGAATCTGCCCATCACCTCTGGGCTGAATCCGGTTCTCGTCAGTAA ATGGTGAAGGATCGGAAGATCGGAGTTGCTCTGGATTTCTCCAACAGTAGCAAAAATGCTCTCAAATGGGCCATCGACAACTTAGCCGACAAGGGCGACACTCTCTTCATCATCTATGTTAACACCAACTCACTCAACGAATCTGCCCATCACCTCTGGGCTGAATCCGGTTCTCGTCAGTAA ATGGTGAAGGATCGGAAGATCGGAGTTGCTCTGGATTTCTCCAACAGTAGCAAAAATGCTCTCAAATGGGCCATCGACAACTTAGCCGACAAGGGCGACACTCTCTTCATCATCTATGTTAACACCAACTCACTCAACGAATCTGCCCATCACCTCTGGGCTGAATCCGGTTCTCGTCAGTAA MVKDRKIGVALDFSNSSKNALKWAIDNLADKGDTLFIIYVNTNSLNESAHHLWAESGSRQ
BLAST of Lsi03G021550 vs. TrEMBL
Match: A0A0A0LDK3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G733270 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 3.1e-22 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of Lsi03G021550 vs. TrEMBL
Match: W9RS34_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_023651 PE=4 SV=1) HSP 1 Score: 99.0 bits (245), Expect = 2.1e-18 Identity = 46/58 (79.31%), Postives = 54/58 (93.10%), Query Frame = 1
BLAST of Lsi03G021550 vs. TrEMBL
Match: I1JLY6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_04G107900 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.8e-17 Identity = 43/58 (74.14%), Postives = 53/58 (91.38%), Query Frame = 1
BLAST of Lsi03G021550 vs. TrEMBL
Match: I1JLY5_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_04G107900 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.8e-17 Identity = 43/58 (74.14%), Postives = 53/58 (91.38%), Query Frame = 1
BLAST of Lsi03G021550 vs. TrEMBL
Match: A0A0B2Q787_GLYSO (Universal stress protein A-like protein OS=Glycine soja GN=glysoja_036951 PE=4 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.8e-17 Identity = 43/58 (74.14%), Postives = 53/58 (91.38%), Query Frame = 1
BLAST of Lsi03G021550 vs. TAIR10
Match: AT3G53990.1 (AT3G53990.1 Adenine nucleotide alpha hydrolases-like superfamily protein) HSP 1 Score: 79.7 bits (195), Expect = 6.7e-16 Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 1
BLAST of Lsi03G021550 vs. TAIR10
Match: AT3G03270.1 (AT3G03270.1 Adenine nucleotide alpha hydrolases-like superfamily protein) HSP 1 Score: 52.8 bits (125), Expect = 8.7e-08 Identity = 24/58 (41.38%), Postives = 39/58 (67.24%), Query Frame = 1
BLAST of Lsi03G021550 vs. TAIR10
Match: AT3G17020.1 (AT3G17020.1 Adenine nucleotide alpha hydrolases-like superfamily protein) HSP 1 Score: 50.4 bits (119), Expect = 4.3e-07 Identity = 26/55 (47.27%), Postives = 34/55 (61.82%), Query Frame = 1
BLAST of Lsi03G021550 vs. NCBI nr
Match: gi|659083695|ref|XP_008442491.1| (PREDICTED: uncharacterized protein C167.05 [Cucumis melo]) HSP 1 Score: 112.1 bits (279), Expect = 3.4e-22 Identity = 54/58 (93.10%), Postives = 56/58 (96.55%), Query Frame = 1
BLAST of Lsi03G021550 vs. NCBI nr
Match: gi|778683406|ref|XP_011651876.1| (PREDICTED: uncharacterized protein C167.05 [Cucumis sativus]) HSP 1 Score: 111.7 bits (278), Expect = 4.5e-22 Identity = 54/58 (93.10%), Postives = 55/58 (94.83%), Query Frame = 1
BLAST of Lsi03G021550 vs. NCBI nr
Match: gi|1009157959|ref|XP_015897028.1| (PREDICTED: uncharacterized protein C167.05 [Ziziphus jujuba]) HSP 1 Score: 100.9 bits (250), Expect = 7.9e-19 Identity = 47/58 (81.03%), Postives = 54/58 (93.10%), Query Frame = 1
BLAST of Lsi03G021550 vs. NCBI nr
Match: gi|703119382|ref|XP_010101861.1| (hypothetical protein L484_023651 [Morus notabilis]) HSP 1 Score: 99.0 bits (245), Expect = 3.0e-18 Identity = 46/58 (79.31%), Postives = 54/58 (93.10%), Query Frame = 1
BLAST of Lsi03G021550 vs. NCBI nr
Match: gi|947114126|gb|KRH62428.1| (hypothetical protein GLYMA_04G107900 [Glycine max]) HSP 1 Score: 95.9 bits (237), Expect = 2.6e-17 Identity = 43/58 (74.14%), Postives = 53/58 (91.38%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |