Lsi03G006120 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTAAATCATCTTATGCTCAAAACTCAGCTCAAGACTACATCAATCGCCACAACTCAGCAAGATCAATAGTGGGTGTTGGAAATATTGTATGGAACACAACTCTTGCGGCCTATGCTCAAACATATGCCAACTCAAGGAAAGCTGATTGCCAATTGGTGCATTCCAATGGGCCTTATGGAGAGAACCTTGCAAAGGGCAACAATATAATGGATTCACTGGCACAGCTGCAGTGA ATGGTTAAATCATCTTATGCTCAAAACTCAGCTCAAGACTACATCAATCGCCACAACTCAGCAAGATCAATAGTGGGTGTTGGAAATATTGTATGGAACACAACTCTTGCGGCCTATGCTCAAACATATGCCAACTCAAGGAAAGCTGATTGCCAATTGGTGCATTCCAATGGGCCTTATGGAGAGAACCTTGCAAAGGGCAACAATATAATGGATTCACTGGCACAGCTGCAGTGA ATGGTTAAATCATCTTATGCTCAAAACTCAGCTCAAGACTACATCAATCGCCACAACTCAGCAAGATCAATAGTGGGTGTTGGAAATATTGTATGGAACACAACTCTTGCGGCCTATGCTCAAACATATGCCAACTCAAGGAAAGCTGATTGCCAATTGGTGCATTCCAATGGGCCTTATGGAGAGAACCTTGCAAAGGGCAACAATATAATGGATTCACTGGCACAGCTGCAGTGA MVKSSYAQNSAQDYINRHNSARSIVGVGNIVWNTTLAAYAQTYANSRKADCQLVHSNGPYGENLAKGNNIMDSLAQLQ
BLAST of Lsi03G006120 vs. Swiss-Prot
Match: PRB1_TOBAC (Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1) HSP 1 Score: 90.1 bits (222), Expect = 1.1e-17 Identity = 41/65 (63.08%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of Lsi03G006120 vs. Swiss-Prot
Match: PRB1_ARATH (Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 1.9e-17 Identity = 41/69 (59.42%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Lsi03G006120 vs. Swiss-Prot
Match: PR12_HORVU (Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 9.7e-17 Identity = 41/68 (60.29%), Postives = 50/68 (73.53%), Query Frame = 1
BLAST of Lsi03G006120 vs. Swiss-Prot
Match: PR1_HORVU (Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 87.0 bits (214), Expect = 9.7e-17 Identity = 41/68 (60.29%), Postives = 50/68 (73.53%), Query Frame = 1
BLAST of Lsi03G006120 vs. Swiss-Prot
Match: PR13_HORVU (Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 2.2e-16 Identity = 40/68 (58.82%), Postives = 50/68 (73.53%), Query Frame = 1
BLAST of Lsi03G006120 vs. TrEMBL
Match: A0A0A0K2D0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G070252 PE=3 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.1e-26 Identity = 59/69 (85.51%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G006120 vs. TrEMBL
Match: V4KGY0_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10011955mg PE=3 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 5.0e-20 Identity = 47/69 (68.12%), Postives = 60/69 (86.96%), Query Frame = 1
BLAST of Lsi03G006120 vs. TrEMBL
Match: A0A087H1E9_ARAAL (Uncharacterized protein OS=Arabis alpina GN=AALP_AA4G059500 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.1e-19 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
BLAST of Lsi03G006120 vs. TrEMBL
Match: Q9LPM7_ARATH (F2J10.6 protein OS=Arabidopsis thaliana GN=F2J10.6 PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.9e-19 Identity = 47/69 (68.12%), Postives = 59/69 (85.51%), Query Frame = 1
BLAST of Lsi03G006120 vs. TrEMBL
Match: V4RNM8_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10029873mg PE=3 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.9e-19 Identity = 47/75 (62.67%), Postives = 59/75 (78.67%), Query Frame = 1
BLAST of Lsi03G006120 vs. TAIR10
Match: AT1G50060.1 (AT1G50060.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 102.8 bits (255), Expect = 9.6e-23 Identity = 47/69 (68.12%), Postives = 59/69 (85.51%), Query Frame = 1
BLAST of Lsi03G006120 vs. TAIR10
Match: AT2G14580.1 (AT2G14580.1 basic pathogenesis-related protein 1) HSP 1 Score: 89.4 bits (220), Expect = 1.1e-18 Identity = 41/69 (59.42%), Postives = 50/69 (72.46%), Query Frame = 1
BLAST of Lsi03G006120 vs. TAIR10
Match: AT1G50050.1 (AT1G50050.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 89.0 bits (219), Expect = 1.4e-18 Identity = 42/72 (58.33%), Postives = 54/72 (75.00%), Query Frame = 1
BLAST of Lsi03G006120 vs. TAIR10
Match: AT2G14610.1 (AT2G14610.1 pathogenesis-related gene 1) HSP 1 Score: 79.7 bits (195), Expect = 8.7e-16 Identity = 36/75 (48.00%), Postives = 52/75 (69.33%), Query Frame = 1
BLAST of Lsi03G006120 vs. TAIR10
Match: AT4G33720.1 (AT4G33720.1 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein) HSP 1 Score: 75.5 bits (184), Expect = 1.6e-14 Identity = 35/69 (50.72%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of Lsi03G006120 vs. NCBI nr
Match: gi|778724764|ref|XP_004136923.2| (PREDICTED: pathogenesis-related leaf protein 6-like [Cucumis sativus]) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 59/69 (85.51%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G006120 vs. NCBI nr
Match: gi|659110131|ref|XP_008455065.1| (PREDICTED: pathogenesis-related leaf protein 6-like [Cucumis melo]) HSP 1 Score: 120.6 bits (301), Expect = 1.3e-24 Identity = 57/63 (90.48%), Postives = 58/63 (92.06%), Query Frame = 1
BLAST of Lsi03G006120 vs. NCBI nr
Match: gi|567133267|ref|XP_006393183.1| (hypothetical protein EUTSA_v10011955mg [Eutrema salsugineum]) HSP 1 Score: 104.8 bits (260), Expect = 7.2e-20 Identity = 47/69 (68.12%), Postives = 60/69 (86.96%), Query Frame = 1
BLAST of Lsi03G006120 vs. NCBI nr
Match: gi|470106702|ref|XP_004289701.1| (PREDICTED: pathogenesis-related protein 1B-like [Fragaria vesca subsp. vesca]) HSP 1 Score: 104.4 bits (259), Expect = 9.3e-20 Identity = 48/68 (70.59%), Postives = 58/68 (85.29%), Query Frame = 1
BLAST of Lsi03G006120 vs. NCBI nr
Match: gi|674243186|gb|KFK35951.1| (hypothetical protein AALP_AA4G059500 [Arabis alpina]) HSP 1 Score: 103.6 bits (257), Expect = 1.6e-19 Identity = 47/63 (74.60%), Postives = 55/63 (87.30%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |