Lsi03G005570 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TATCGAGTTGTGGTGAAATTAATCTCTCGTTTGAGATATCCTTGTCAAGAATGGACGATTGCATTAGAGATAAGTCCTCATGTCTTGACTTTGGCTAAAAATTTCCAAGGTGGCCATCAAGTGCTAAGGAGTTGTTTCCAAAGTCTTTTTCTACTGACTAATGAGGTAATTACTTAACTTTATTTTAAGAGAAATAGGTGTCAAAATTTTATTTATTTAAAATTATAGAAAGTAAGAAATAATGAATGGTCGTTGCATATATGACATGCAGTTGATCCTGCTTAGAATAGTACAAAATTGTTCAAACCTAGCGAGAGATAAAGAGGGTTGTTGTATACTTCAATCGTGCATTGAATATTCCTATAATAATATAGGACGACATCAAGAAATTCTAATCTTATAG TATCGAGTTGTGGTGAAATTAATCTCTCGTTTGAGATATCCTTGTCAAGAATGGACGATTGCATTAGAGATAAGTCCTCATGTCTTGACTTTGGCTAAAAATTTCCAAGGTGGCCATCAAGTGCTAAGGAGTTGTTTCCAAAGTCTTTTTCTACTGACTAATGAGTTGATCCTGCTTAGAATAGTACAAAATTGTTCAAACCTAGCGAGAGATAAAGAGGGTTGTTGTATACTTCAATCGTGCATTGAATATTCCTATAATAATATAGGACGACATCAAGAAATTCTAATCTTATAG TATCGAGTTGTGGTGAAATTAATCTCTCGTTTGAGATATCCTTGTCAAGAATGGACGATTGCATTAGAGATAAGTCCTCATGTCTTGACTTTGGCTAAAAATTTCCAAGGTGGCCATCAAGTGCTAAGGAGTTGTTTCCAAAGTCTTTTTCTACTGACTAATGAGTTGATCCTGCTTAGAATAGTACAAAATTGTTCAAACCTAGCGAGAGATAAAGAGGGTTGTTGTATACTTCAATCGTGCATTGAATATTCCTATAATAATATAGGACGACATCAAGAAATTCTAATCTTATAG YRVVVKLISRLRYPCQEWTIALEISPHVLTLAKNFQGGHQVLRSCFQSLFLLTNELILLRIVQNCSNLARDKEGCCILQSCIEYSYNNIGRHQEILIL
BLAST of Lsi03G005570 vs. Swiss-Prot
Match: PUM9_ARATH (Pumilio homolog 9 OS=Arabidopsis thaliana GN=APUM9 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.6e-08 Identity = 33/96 (34.38%), Postives = 52/96 (54.17%), Query Frame = 1
BLAST of Lsi03G005570 vs. Swiss-Prot
Match: PUM7_ARATH (Putative pumilio homolog 7, chloroplastic OS=Arabidopsis thaliana GN=APUM7 PE=3 SV=2) HSP 1 Score: 56.6 bits (135), Expect = 1.8e-07 Identity = 30/84 (35.71%), Postives = 44/84 (52.38%), Query Frame = 1
BLAST of Lsi03G005570 vs. TrEMBL
Match: M5XWB3_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa024026mg PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 35/96 (36.46%), Postives = 54/96 (56.25%), Query Frame = 1
BLAST of Lsi03G005570 vs. TrEMBL
Match: A0A059AG22_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_J01757 PE=4 SV=1) HSP 1 Score: 63.5 bits (153), Expect = 1.6e-07 Identity = 31/91 (34.07%), Postives = 45/91 (49.45%), Query Frame = 1
BLAST of Lsi03G005570 vs. TrEMBL
Match: A0A164TC01_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_024462 PE=4 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.7e-07 Identity = 34/92 (36.96%), Postives = 49/92 (53.26%), Query Frame = 1
BLAST of Lsi03G005570 vs. TrEMBL
Match: W1NJG1_AMBTC (Uncharacterized protein OS=Amborella trichopoda GN=AMTR_s00060p00178160 PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.6e-07 Identity = 33/96 (34.38%), Postives = 51/96 (53.12%), Query Frame = 1
BLAST of Lsi03G005570 vs. TrEMBL
Match: A0A078IX97_BRANA (BnaC09g53960D protein OS=Brassica napus GN=BnaC09g53960D PE=4 SV=1) HSP 1 Score: 62.4 bits (150), Expect = 3.6e-07 Identity = 35/96 (36.46%), Postives = 55/96 (57.29%), Query Frame = 1
BLAST of Lsi03G005570 vs. TAIR10
Match: AT1G35730.1 (AT1G35730.1 pumilio 9) HSP 1 Score: 58.5 bits (140), Expect = 2.6e-09 Identity = 33/96 (34.38%), Postives = 52/96 (54.17%), Query Frame = 1
BLAST of Lsi03G005570 vs. TAIR10
Match: AT1G78160.1 (AT1G78160.1 pumilio 7) HSP 1 Score: 56.6 bits (135), Expect = 9.9e-09 Identity = 30/84 (35.71%), Postives = 44/84 (52.38%), Query Frame = 1
BLAST of Lsi03G005570 vs. TAIR10
Match: AT5G56510.1 (AT5G56510.1 pumilio 12) HSP 1 Score: 50.4 bits (119), Expect = 7.1e-07 Identity = 29/92 (31.52%), Postives = 45/92 (48.91%), Query Frame = 1
BLAST of Lsi03G005570 vs. NCBI nr
Match: gi|659110995|ref|XP_008455521.1| (PREDICTED: putative pumilio homolog 8, chloroplastic [Cucumis melo]) HSP 1 Score: 141.4 bits (355), Expect = 8.7e-31 Identity = 66/97 (68.04%), Postives = 79/97 (81.44%), Query Frame = 1
BLAST of Lsi03G005570 vs. NCBI nr
Match: gi|1009170802|ref|XP_015866393.1| (PREDICTED: pumilio homology domain family member 4-like [Ziziphus jujuba]) HSP 1 Score: 64.3 bits (155), Expect = 1.3e-07 Identity = 32/84 (38.10%), Postives = 48/84 (57.14%), Query Frame = 1
BLAST of Lsi03G005570 vs. NCBI nr
Match: gi|698499412|ref|XP_009795534.1| (PREDICTED: pumilio homolog 12-like [Nicotiana sylvestris]) HSP 1 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
BLAST of Lsi03G005570 vs. NCBI nr
Match: gi|1012216736|ref|XP_015934649.1| (PREDICTED: putative pumilio homolog 7, chloroplastic [Arachis duranensis]) HSP 1 Score: 63.9 bits (154), Expect = 1.8e-07 Identity = 38/96 (39.58%), Postives = 52/96 (54.17%), Query Frame = 1
BLAST of Lsi03G005570 vs. NCBI nr
Match: gi|598009297|ref|XP_007336583.1| (ARM repeat-containing protein [Auricularia subglabra TFB-10046 SS5]) HSP 1 Score: 63.5 bits (153), Expect = 2.3e-07 Identity = 32/84 (38.10%), Postives = 47/84 (55.95%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |