Lsi03G004050 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGGATTGGGGCCCTGTTCTAATAGCCGTAATACTGTTCGTAATTCTGAGCCCCGGAGTTCTGTTTCAGTTGCCCAGCAAAAACAGAGTTGTGGAGTTCCTCAATATGCAGACCAGCGCCATCTCCATCTTCGTCCACACCATCATCTACTTTGGCCTCATCACTGTCTTTCTCATCGCCATTGGCGTTCACATTTCCAGTGGCTAA ATGGGGGATTGGGGCCCTGTTCTAATAGCCGTAATACTGTTCGTAATTCTGAGCCCCGGAGTTCTGTTTCAGTTGCCCAGCAAAAACAGAGTTGTGGAGTTCCTCAATATGCAGACCAGCGCCATCTCCATCTTCGTCCACACCATCATCTACTTTGGCCTCATCACTGTCTTTCTCATCGCCATTGGCGTTCACATTTCCAGTGGCTAA ATGGGGGATTGGGGCCCTGTTCTAATAGCCGTAATACTGTTCGTAATTCTGAGCCCCGGAGTTCTGTTTCAGTTGCCCAGCAAAAACAGAGTTGTGGAGTTCCTCAATATGCAGACCAGCGCCATCTCCATCTTCGTCCACACCATCATCTACTTTGGCCTCATCACTGTCTTTCTCATCGCCATTGGCGTTCACATTTCCAGTGGCTAA MGDWGPVLIAVILFVILSPGVLFQLPSKNRVVEFLNMQTSAISIFVHTIIYFGLITVFLIAIGVHISSG
BLAST of Lsi03G004050 vs. TrEMBL
Match: B9RBG4_RICCO (Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1676560 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 6.2e-22 Identity = 53/69 (76.81%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004050 vs. TrEMBL
Match: A0A0A0LMX4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G406080 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 6.2e-22 Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004050 vs. TrEMBL
Match: B9GZN7_POPTR (Uncharacterized protein (Fragment) OS=Populus trichocarpa GN=POPTR_0003s16890g PE=4 SV=2) HSP 1 Score: 110.2 bits (274), Expect = 1.0e-21 Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004050 vs. TrEMBL
Match: I1MYD6_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_18G005000 PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.3e-21 Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004050 vs. TrEMBL
Match: V7D3F5_PHAVU (Uncharacterized protein OS=Phaseolus vulgaris GN=PHAVU_001G263200g PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 2.3e-21 Identity = 54/69 (78.26%), Postives = 63/69 (91.30%), Query Frame = 1
BLAST of Lsi03G004050 vs. TAIR10
Match: AT5G63500.1 (AT5G63500.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 100.1 bits (248), Expect = 5.5e-22 Identity = 52/69 (75.36%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of Lsi03G004050 vs. TAIR10
Match: AT3G48660.1 (AT3G48660.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 97.4 bits (241), Expect = 3.6e-21 Identity = 48/69 (69.57%), Postives = 60/69 (86.96%), Query Frame = 1
BLAST of Lsi03G004050 vs. TAIR10
Match: AT5G08391.1 (AT5G08391.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 88.6 bits (218), Expect = 1.7e-18 Identity = 41/69 (59.42%), Postives = 56/69 (81.16%), Query Frame = 1
BLAST of Lsi03G004050 vs. TAIR10
Match: AT5G40980.1 (AT5G40980.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 85.9 bits (211), Expect = 1.1e-17 Identity = 41/64 (64.06%), Postives = 54/64 (84.38%), Query Frame = 1
BLAST of Lsi03G004050 vs. TAIR10
Match: AT3G27027.1 (AT3G27027.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 83.2 bits (204), Expect = 7.0e-17 Identity = 40/64 (62.50%), Postives = 53/64 (82.81%), Query Frame = 1
BLAST of Lsi03G004050 vs. NCBI nr
Match: gi|659081410|ref|XP_008441320.1| (PREDICTED: uncharacterized protein LOC103485470 [Cucumis melo]) HSP 1 Score: 117.1 bits (292), Expect = 1.2e-23 Identity = 58/69 (84.06%), Postives = 67/69 (97.10%), Query Frame = 1
BLAST of Lsi03G004050 vs. NCBI nr
Match: gi|802539272|ref|XP_012070204.1| (PREDICTED: uncharacterized protein LOC105632430 [Jatropha curcas]) HSP 1 Score: 112.5 bits (280), Expect = 3.0e-22 Identity = 54/69 (78.26%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of Lsi03G004050 vs. NCBI nr
Match: gi|255536863|ref|XP_002509498.1| (PREDICTED: uncharacterized protein LOC8271433 [Ricinus communis]) HSP 1 Score: 110.9 bits (276), Expect = 8.8e-22 Identity = 53/69 (76.81%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004050 vs. NCBI nr
Match: gi|778673217|ref|XP_011649952.1| (PREDICTED: uncharacterized protein LOC101212375 [Cucumis sativus]) HSP 1 Score: 110.9 bits (276), Expect = 8.8e-22 Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004050 vs. NCBI nr
Match: gi|566163091|ref|XP_002304675.2| (hypothetical protein POPTR_0003s16890g, partial [Populus trichocarpa]) HSP 1 Score: 110.2 bits (274), Expect = 1.5e-21 Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|