Lsi03G004040 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGGATTGGGCACCGGTGGTGATCGGAGTTGTACTGTTCGTACTGCTCTCTCCGGGGCTTCTGTTCCAGTTTCCGGGAAATAATCGGCAGTTTGAGTTCGGGAGCATGAAGACCAACGGCAAGGCTGTCGCTATACACACGCTCATCTTCTTCATCCTCTATGCCGTCTTCATTCTCGCTCTCCATATCCACATCTACACTGGCTGA ATGTCGGATTGGGCACCGGTGGTGATCGGAGTTGTACTGTTCGTACTGCTCTCTCCGGGGCTTCTGTTCCAGTTTCCGGGAAATAATCGGCAGTTTGAGTTCGGGAGCATGAAGACCAACGGCAAGGCTGTCGCTATACACACGCTCATCTTCTTCATCCTCTATGCCGTCTTCATTCTCGCTCTCCATATCCACATCTACACTGGCTGA ATGTCGGATTGGGCACCGGTGGTGATCGGAGTTGTACTGTTCGTACTGCTCTCTCCGGGGCTTCTGTTCCAGTTTCCGGGAAATAATCGGCAGTTTGAGTTCGGGAGCATGAAGACCAACGGCAAGGCTGTCGCTATACACACGCTCATCTTCTTCATCCTCTATGCCGTCTTCATTCTCGCTCTCCATATCCACATCTACACTGGCTGA MSDWAPVVIGVVLFVLLSPGLLFQFPGNNRQFEFGSMKTNGKAVAIHTLIFFILYAVFILALHIHIYTG
BLAST of Lsi03G004040 vs. TrEMBL
Match: A0A0A0LMK8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G406095 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 4.7e-30 Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Lsi03G004040 vs. TrEMBL
Match: A0A164VTJ6_DAUCA (Uncharacterized protein OS=Daucus carota subsp. sativus GN=DCAR_021798 PE=4 SV=1) HSP 1 Score: 124.0 bits (310), Expect = 7.0e-26 Identity = 55/69 (79.71%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of Lsi03G004040 vs. TrEMBL
Match: A0A067FKC6_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g035267mg PE=4 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 1.3e-24 Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004040 vs. TrEMBL
Match: A0A068V855_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00019177001 PE=4 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 1.7e-24 Identity = 54/69 (78.26%), Postives = 63/69 (91.30%), Query Frame = 1
BLAST of Lsi03G004040 vs. TrEMBL
Match: A0A0D2PXJ7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G272700 PE=4 SV=1) HSP 1 Score: 119.0 bits (297), Expect = 2.3e-24 Identity = 54/69 (78.26%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Lsi03G004040 vs. TAIR10
Match: AT3G27030.1 (AT3G27030.1 unknown protein) HSP 1 Score: 110.5 bits (275), Expect = 4.1e-25 Identity = 49/69 (71.01%), Postives = 61/69 (88.41%), Query Frame = 1
BLAST of Lsi03G004040 vs. TAIR10
Match: AT5G40970.1 (AT5G40970.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 100.5 bits (249), Expect = 4.2e-22 Identity = 45/69 (65.22%), Postives = 58/69 (84.06%), Query Frame = 1
BLAST of Lsi03G004040 vs. TAIR10
Match: AT3G48660.1 (AT3G48660.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 89.7 bits (221), Expect = 7.4e-19 Identity = 39/69 (56.52%), Postives = 54/69 (78.26%), Query Frame = 1
BLAST of Lsi03G004040 vs. TAIR10
Match: AT5G63500.1 (AT5G63500.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 86.3 bits (212), Expect = 8.2e-18 Identity = 37/69 (53.62%), Postives = 54/69 (78.26%), Query Frame = 1
BLAST of Lsi03G004040 vs. TAIR10
Match: AT5G08391.1 (AT5G08391.1 Protein of unknown function (DUF 3339)) HSP 1 Score: 84.7 bits (208), Expect = 2.4e-17 Identity = 38/69 (55.07%), Postives = 53/69 (76.81%), Query Frame = 1
BLAST of Lsi03G004040 vs. NCBI nr
Match: gi|659081414|ref|XP_008441322.1| (PREDICTED: uncharacterized protein LOC103485472 [Cucumis melo]) HSP 1 Score: 137.9 bits (346), Expect = 6.7e-30 Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Lsi03G004040 vs. NCBI nr
Match: gi|1021033053|gb|KZM90837.1| (hypothetical protein DCAR_021798 [Daucus carota subsp. sativus]) HSP 1 Score: 124.0 bits (310), Expect = 1.0e-25 Identity = 55/69 (79.71%), Postives = 66/69 (95.65%), Query Frame = 1
BLAST of Lsi03G004040 vs. NCBI nr
Match: gi|1009151967|ref|XP_015893838.1| (PREDICTED: uncharacterized protein LOC107427943 isoform X1 [Ziziphus jujuba]) HSP 1 Score: 123.2 bits (308), Expect = 1.7e-25 Identity = 57/69 (82.61%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of Lsi03G004040 vs. NCBI nr
Match: gi|1009151971|ref|XP_015893840.1| (PREDICTED: uncharacterized protein LOC107427943 isoform X2 [Ziziphus jujuba]) HSP 1 Score: 123.2 bits (308), Expect = 1.7e-25 Identity = 57/69 (82.61%), Postives = 65/69 (94.20%), Query Frame = 1
BLAST of Lsi03G004040 vs. NCBI nr
Match: gi|823254744|ref|XP_012460019.1| (PREDICTED: uncharacterized protein LOC105780313 [Gossypium raimondii]) HSP 1 Score: 121.3 bits (303), Expect = 6.5e-25 Identity = 57/69 (82.61%), Postives = 65/69 (94.20%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|