Lsi03G002390 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATAGCCGTCGACTTTCGAAACTTCAATCCCATTCAATGGAGGACTTCTCAATTCTTGCGATTCCCAGCCCAGTGCATATTAATTACTGATTGCCATCGTCGACTATTGCTGGTGACTCAAATGTTGTCTGGACTTGTTTTTATTTATTTTATTTTATTATTTTTAAAAATTTTATTTTATTCATGTTTCGGCTAGAGCAATTATTTAATGTTTGAAATGAACATTGCAAATTTCAGGAATCTATACTGTTGTGGCAAAGAAAATGCGAGGAAGCACTCTATTCTCTGCTCATTCTTGGTGCCAGACGACCGGTGCGTCATCTCGCATCAGTAGTAATGGCAAGAATCATAACCAAGGGAGATACAATTTCGGTGTATTCACGAGTTAGTAGTCTTCAAGGGTTTCTATCTGATGGGAAAAGGAATGAACCTCATAAGATTGCTGGTTTGTTACGAAAGCTTGAACTTGATTAG ATGCATAGCCGTCGACTTTCGAAACTTCAATCCCATTCAATGGAGGACTTCTCAATTCTTGCGATTCCCAGCCCAGAATCTATACTGTTGTGGCAAAGAAAATGCGAGGAAGCACTCTATTCTCTGCTCATTCTTGGTGCCAGACGACCGGTGCGTCATCTCGCATCAGTAGTAATGGCAAGAATCATAACCAAGGGAGATACAATTTCGGTGTATTCACGAGTTAGTAGTCTTCAAGGGTTTCTATCTGATGGGAAAAGGAATGAACCTCATAAGATTGCTGGTTTGTTACGAAAGCTTGAACTTGATTAG ATGCATAGCCGTCGACTTTCGAAACTTCAATCCCATTCAATGGAGGACTTCTCAATTCTTGCGATTCCCAGCCCAGAATCTATACTGTTGTGGCAAAGAAAATGCGAGGAAGCACTCTATTCTCTGCTCATTCTTGGTGCCAGACGACCGGTGCGTCATCTCGCATCAGTAGTAATGGCAAGAATCATAACCAAGGGAGATACAATTTCGGTGTATTCACGAGTTAGTAGTCTTCAAGGGTTTCTATCTGATGGGAAAAGGAATGAACCTCATAAGATTGCTGGTTTGTTACGAAAGCTTGAACTTGATTAG MHSRRLSKLQSHSMEDFSILAIPSPESILLWQRKCEEALYSLLILGARRPVRHLASVVMARIITKGDTISVYSRVSSLQGFLSDGKRNEPHKIAGLLRKLELD
BLAST of Lsi03G002390 vs. TrEMBL
Match: W9RXJ4_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_008656 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 2.8e-26 Identity = 61/69 (88.41%), Postives = 67/69 (97.10%), Query Frame = 1
BLAST of Lsi03G002390 vs. TrEMBL
Match: A0A067EUX8_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0013683mg PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 8.0e-26 Identity = 61/70 (87.14%), Postives = 66/70 (94.29%), Query Frame = 1
BLAST of Lsi03G002390 vs. TrEMBL
Match: V4S945_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10011943mg PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 8.0e-26 Identity = 61/70 (87.14%), Postives = 66/70 (94.29%), Query Frame = 1
BLAST of Lsi03G002390 vs. TrEMBL
Match: F6HSF0_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0006g03170 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 8.0e-26 Identity = 60/70 (85.71%), Postives = 67/70 (95.71%), Query Frame = 1
BLAST of Lsi03G002390 vs. TrEMBL
Match: A0A0D2LQG1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_001G080300 PE=4 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.4e-25 Identity = 60/70 (85.71%), Postives = 67/70 (95.71%), Query Frame = 1
BLAST of Lsi03G002390 vs. TAIR10
Match: AT1G67140.3 (AT1G67140.3 HEAT repeat-containing protein) HSP 1 Score: 110.2 bits (274), Expect = 7.9e-25 Identity = 52/70 (74.29%), Postives = 64/70 (91.43%), Query Frame = 1
BLAST of Lsi03G002390 vs. NCBI nr
Match: gi|659119089|ref|XP_008459470.1| (PREDICTED: HEAT repeat-containing protein 5B isoform X2 [Cucumis melo]) HSP 1 Score: 137.5 bits (345), Expect = 1.3e-29 Identity = 69/75 (92.00%), Postives = 73/75 (97.33%), Query Frame = 1
BLAST of Lsi03G002390 vs. NCBI nr
Match: gi|659119091|ref|XP_008459471.1| (PREDICTED: HEAT repeat-containing protein 5B isoform X3 [Cucumis melo]) HSP 1 Score: 137.5 bits (345), Expect = 1.3e-29 Identity = 69/75 (92.00%), Postives = 73/75 (97.33%), Query Frame = 1
BLAST of Lsi03G002390 vs. NCBI nr
Match: gi|659119087|ref|XP_008459469.1| (PREDICTED: HEAT repeat-containing protein 5B isoform X1 [Cucumis melo]) HSP 1 Score: 137.5 bits (345), Expect = 1.3e-29 Identity = 69/75 (92.00%), Postives = 73/75 (97.33%), Query Frame = 1
BLAST of Lsi03G002390 vs. NCBI nr
Match: gi|778707626|ref|XP_011656034.1| (PREDICTED: HEAT repeat-containing protein 5B [Cucumis sativus]) HSP 1 Score: 137.1 bits (344), Expect = 1.7e-29 Identity = 70/75 (93.33%), Postives = 72/75 (96.00%), Query Frame = 1
BLAST of Lsi03G002390 vs. NCBI nr
Match: gi|703127333|ref|XP_010103804.1| (hypothetical protein L484_008656 [Morus notabilis]) HSP 1 Score: 125.9 bits (315), Expect = 4.0e-26 Identity = 61/69 (88.41%), Postives = 67/69 (97.10%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|