Lsi02G025690 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGAGGAGAAGCAGAAGCTCAACGGCGGAGTCGCCGGACGATCCTTGGTGGAGGTGAATCCGAAGCCGAGTAAAGGGCTCACATCGAAGGCCACCGATTTGTTGGAGAAGCTGTTTGTCAAGCTTATGTATGATTCTTCAAGGCCTCAGCATTATCTTTCCGGTAATTTCGCTCCGGTTCACGATGAGACTCCTCCCATTACCGATCTTCCTGTTAAAGGTTATCTTCCGGTGAGTTGTAATCTGCTTTCTGATCTGGTGTTTGTTTATTCAGAACTGTTGCTTAATGAATTCAACTGGGTTTAG ATGGCGGAGGAGAAGCAGAAGCTCAACGGCGGAGTCGCCGGACGATCCTTGGTGGAGGTGAATCCGAAGCCGAGTAAAGGGCTCACATCGAAGGCCACCGATTTGTTGGAGAAGCTGTTTGTCAAGCTTATGTATGATTCTTCAAGGCCTCAGCATTATCTTTCCGGTAATTTCGCTCCGGTTCACGATGAGACTCCTCCCATTACCGATCTTCCTGTTAAAGGTTATCTTCCGGTGAGTTGTAATCTGCTTTCTGATCTGGTGTTTGTTTATTCAGAACTGTTGCTTAATGAATTCAACTGGGTTTAG ATGGCGGAGGAGAAGCAGAAGCTCAACGGCGGAGTCGCCGGACGATCCTTGGTGGAGGTGAATCCGAAGCCGAGTAAAGGGCTCACATCGAAGGCCACCGATTTGTTGGAGAAGCTGTTTGTCAAGCTTATGTATGATTCTTCAAGGCCTCAGCATTATCTTTCCGGTAATTTCGCTCCGGTTCACGATGAGACTCCTCCCATTACCGATCTTCCTGTTAAAGGTTATCTTCCGGTGAGTTGTAATCTGCTTTCTGATCTGGTGTTTGTTTATTCAGAACTGTTGCTTAATGAATTCAACTGGGTTTAG MAEEKQKLNGGVAGRSLVEVNPKPSKGLTSKATDLLEKLFVKLMYDSSRPQHYLSGNFAPVHDETPPITDLPVKGYLPVSCNLLSDLVFVYSELLLNEFNWV
BLAST of Lsi02G025690 vs. Swiss-Prot
Match: CCD1_ARATH (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Arabidopsis thaliana GN=CCD1 PE=1 SV=2) HSP 1 Score: 99.4 bits (246), Expect = 2.5e-20 Identity = 44/69 (63.77%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of Lsi02G025690 vs. Swiss-Prot
Match: CCD1_PEA (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Pisum sativum GN=CCD1 PE=2 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 7.2e-20 Identity = 45/66 (68.18%), Postives = 52/66 (78.79%), Query Frame = 1
BLAST of Lsi02G025690 vs. Swiss-Prot
Match: CCD_CROSA (Carotenoid 9,10(9',10')-cleavage dioxygenase OS=Crocus sativus GN=CCD PE=1 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 2.7e-19 Identity = 45/68 (66.18%), Postives = 52/68 (76.47%), Query Frame = 1
BLAST of Lsi02G025690 vs. Swiss-Prot
Match: CCD1_PHAVU (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Phaseolus vulgaris GN=CCD1 PE=1 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 6.7e-18 Identity = 47/76 (61.84%), Postives = 54/76 (71.05%), Query Frame = 1
BLAST of Lsi02G025690 vs. Swiss-Prot
Match: CCD1_ONCHC (Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Oncidium hybrid cultivar GN=CCD1 PE=2 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 9.7e-17 Identity = 42/79 (53.16%), Postives = 53/79 (67.09%), Query Frame = 1
BLAST of Lsi02G025690 vs. TrEMBL
Match: K4K0F3_MOMCH (Carotenoid cleavage dioxygenase 1 OS=Momordica charantia GN=CCD1 PE=2 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 2.3e-33 Identity = 73/82 (89.02%), Postives = 74/82 (90.24%), Query Frame = 1
BLAST of Lsi02G025690 vs. TrEMBL
Match: A0A0A0K8B3_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_7G428120 PE=4 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 1.1e-32 Identity = 70/82 (85.37%), Postives = 75/82 (91.46%), Query Frame = 1
BLAST of Lsi02G025690 vs. TrEMBL
Match: Q0H394_CUCME (Carotenoid cleavage dioxygenase (Fragment) OS=Cucumis melo PE=2 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 2.0e-32 Identity = 70/78 (89.74%), Postives = 73/78 (93.59%), Query Frame = 1
BLAST of Lsi02G025690 vs. TrEMBL
Match: A4URT6_9ROSI (9-cis-epoxycarotenoid dioxygenase OS=Castanea mollissima GN=NCED PE=2 SV=1) HSP 1 Score: 114.0 bits (284), Expect = 1.1e-22 Identity = 58/83 (69.88%), Postives = 65/83 (78.31%), Query Frame = 1
BLAST of Lsi02G025690 vs. TrEMBL
Match: U5G3N5_POPTR (Carotenoid cleavage dioxygenase 1 family protein OS=Populus trichocarpa GN=POPTR_0009s06530g PE=4 SV=1) HSP 1 Score: 113.2 bits (282), Expect = 1.8e-22 Identity = 56/80 (70.00%), Postives = 64/80 (80.00%), Query Frame = 1
BLAST of Lsi02G025690 vs. TAIR10
Match: AT3G63520.1 (AT3G63520.1 carotenoid cleavage dioxygenase 1) HSP 1 Score: 99.4 bits (246), Expect = 1.4e-21 Identity = 44/69 (63.77%), Postives = 55/69 (79.71%), Query Frame = 1
BLAST of Lsi02G025690 vs. NCBI nr
Match: gi|659122741|ref|XP_008461300.1| (PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 [Cucumis melo]) HSP 1 Score: 152.5 bits (384), Expect = 3.9e-34 Identity = 73/82 (89.02%), Postives = 77/82 (93.90%), Query Frame = 1
BLAST of Lsi02G025690 vs. NCBI nr
Match: gi|408794951|gb|AFU91489.1| (carotenoid cleavage dioxygenase 1 [Momordica charantia]) HSP 1 Score: 149.4 bits (376), Expect = 3.3e-33 Identity = 73/82 (89.02%), Postives = 74/82 (90.24%), Query Frame = 1
BLAST of Lsi02G025690 vs. NCBI nr
Match: gi|449436307|ref|XP_004135934.1| (PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1 isoform X1 [Cucumis sativus]) HSP 1 Score: 147.1 bits (370), Expect = 1.6e-32 Identity = 70/82 (85.37%), Postives = 75/82 (91.46%), Query Frame = 1
BLAST of Lsi02G025690 vs. NCBI nr
Match: gi|82548252|gb|ABB82946.1| (carotenoid cleavage dioxygenase [Cucumis melo]) HSP 1 Score: 146.4 bits (368), Expect = 2.8e-32 Identity = 70/78 (89.74%), Postives = 73/78 (93.59%), Query Frame = 1
BLAST of Lsi02G025690 vs. NCBI nr
Match: gi|743837238|ref|XP_011025444.1| (PREDICTED: carotenoid 9,10(9',10')-cleavage dioxygenase 1-like [Populus euphratica]) HSP 1 Score: 114.8 bits (286), Expect = 9.0e-23 Identity = 57/81 (70.37%), Postives = 65/81 (80.25%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |