Lsi02G016460 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTCAAGTTGTGTTGAAGCTTGCATTGAGCGAAATGGCCATAATTTTGGCTCTGTTGTTCAGAACTCCATTCAGAAATTTGATAGTCAAAGGATTGGACAGATTGAAGCAGGGGAGAGGCCCTTTGGTGGTTAAGTCTGTTGCCGCCACCATGCTGGTCGTCTTTGCCTCAGCTCTTTACAATGCGACGAAAATCGGCCGACGAACGGCGGAGGGCGGCTTCATCAACCAGACTGACGAGATTCTCATGGCGCAGCGCCTTCTCGAAGCCTCCATGATCGGTGAGCTTTAA ATGATTCAAGTTGTGTTGAAGCTTGCATTGAGCGAAATGGCCATAATTTTGGCTCTGTTGTTCAGAACTCCATTCAGAAATTTGATAGTCAAAGGATTGGACAGATTGAAGCAGGGGAGAGGCCCTTTGGTGGTTAAGTCTGTTGCCGCCACCATGCTGGTCGTCTTTGCCTCAGCTCTTTACAATGCGACGAAAATCGGCCGACGAACGGCGGAGGGCGGCTTCATCAACCAGACTGACGAGATTCTCATGGCGCAGCGCCTTCTCGAAGCCTCCATGATCGGTGAGCTTTAA ATGATTCAAGTTGTGTTGAAGCTTGCATTGAGCGAAATGGCCATAATTTTGGCTCTGTTGTTCAGAACTCCATTCAGAAATTTGATAGTCAAAGGATTGGACAGATTGAAGCAGGGGAGAGGCCCTTTGGTGGTTAAGTCTGTTGCCGCCACCATGCTGGTCGTCTTTGCCTCAGCTCTTTACAATGCGACGAAAATCGGCCGACGAACGGCGGAGGGCGGCTTCATCAACCAGACTGACGAGATTCTCATGGCGCAGCGCCTTCTCGAAGCCTCCATGATCGGTGAGCTTTAA MIQVVLKLALSEMAIILALLFRTPFRNLIVKGLDRLKQGRGPLVVKSVAATMLVVFASALYNATKIGRRTAEGGFINQTDEILMAQRLLEASMIGEL
BLAST of Lsi02G016460 vs. TrEMBL
Match: A0A0A0KNS5_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G515050 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 3.9e-30 Identity = 76/95 (80.00%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Lsi02G016460 vs. TrEMBL
Match: M5X389_PRUPE (Uncharacterized protein (Fragment) OS=Prunus persica GN=PRUPE_ppa014571mg PE=4 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 1.3e-22 Identity = 58/94 (61.70%), Postives = 72/94 (76.60%), Query Frame = 1
BLAST of Lsi02G016460 vs. TrEMBL
Match: B9SVA3_RICCO (Bcr-associated protein, bap, putative OS=Ricinus communis GN=RCOM_1303620 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 8.6e-22 Identity = 55/95 (57.89%), Postives = 75/95 (78.95%), Query Frame = 1
BLAST of Lsi02G016460 vs. TrEMBL
Match: A0A151U293_CAJCA (Uncharacterized protein OS=Cajanus cajan GN=KK1_006052 PE=4 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.5e-21 Identity = 57/95 (60.00%), Postives = 72/95 (75.79%), Query Frame = 1
BLAST of Lsi02G016460 vs. TrEMBL
Match: A0A067F7E3_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g045614mg PE=4 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.3e-21 Identity = 56/95 (58.95%), Postives = 73/95 (76.84%), Query Frame = 1
BLAST of Lsi02G016460 vs. TAIR10
Match: AT5G42570.1 (AT5G42570.1 B-cell receptor-associated 31-like) HSP 1 Score: 90.9 bits (224), Expect = 4.7e-19 Identity = 44/95 (46.32%), Postives = 69/95 (72.63%), Query Frame = 1
BLAST of Lsi02G016460 vs. TAIR10
Match: AT1G11905.1 (AT1G11905.1 B-cell receptor-associated protein 31-like ) HSP 1 Score: 87.8 bits (216), Expect = 4.0e-18 Identity = 41/95 (43.16%), Postives = 71/95 (74.74%), Query Frame = 1
BLAST of Lsi02G016460 vs. TAIR10
Match: AT3G20450.1 (AT3G20450.1 B-cell receptor-associated protein 31-like ) HSP 1 Score: 81.6 bits (200), Expect = 2.8e-16 Identity = 46/96 (47.92%), Postives = 64/96 (66.67%), Query Frame = 1
BLAST of Lsi02G016460 vs. TAIR10
Match: AT5G48660.1 (AT5G48660.1 B-cell receptor-associated protein 31-like ) HSP 1 Score: 65.5 bits (158), Expect = 2.1e-11 Identity = 38/96 (39.58%), Postives = 59/96 (61.46%), Query Frame = 1
BLAST of Lsi02G016460 vs. TAIR10
Match: AT3G07190.1 (AT3G07190.1 B-cell receptor-associated protein 31-like ) HSP 1 Score: 61.6 bits (148), Expect = 3.0e-10 Identity = 38/96 (39.58%), Postives = 58/96 (60.42%), Query Frame = 1
BLAST of Lsi02G016460 vs. NCBI nr
Match: gi|778703405|ref|XP_011655362.1| (PREDICTED: uncharacterized protein LOC101213037 isoform X1 [Cucumis sativus]) HSP 1 Score: 138.7 bits (348), Expect = 5.6e-30 Identity = 76/95 (80.00%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Lsi02G016460 vs. NCBI nr
Match: gi|659117981|ref|XP_008458888.1| (PREDICTED: uncharacterized protein LOC103498158 [Cucumis melo]) HSP 1 Score: 138.7 bits (348), Expect = 5.6e-30 Identity = 77/95 (81.05%), Postives = 81/95 (85.26%), Query Frame = 1
BLAST of Lsi02G016460 vs. NCBI nr
Match: gi|778703408|ref|XP_011655363.1| (PREDICTED: uncharacterized protein LOC101213037 isoform X2 [Cucumis sativus]) HSP 1 Score: 136.0 bits (341), Expect = 3.6e-29 Identity = 75/94 (79.79%), Postives = 80/94 (85.11%), Query Frame = 1
BLAST of Lsi02G016460 vs. NCBI nr
Match: gi|694363786|ref|XP_009361097.1| (PREDICTED: uncharacterized protein LOC103951454 [Pyrus x bretschneideri]) HSP 1 Score: 117.9 bits (294), Expect = 1.0e-23 Identity = 59/95 (62.11%), Postives = 76/95 (80.00%), Query Frame = 1
BLAST of Lsi02G016460 vs. NCBI nr
Match: gi|645240990|ref|XP_008226862.1| (PREDICTED: uncharacterized protein LOC103326424 [Prunus mume]) HSP 1 Score: 116.3 bits (290), Expect = 3.0e-23 Identity = 59/95 (62.11%), Postives = 73/95 (76.84%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |