Lsi02G010640 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGTATTTACGGACAAAAGTATTCGGTTATTGGGGAAAAATCAATATACTTCTAATGTCGAATCATGATCAACTAGGACAGAAATAAAACATTGGGTCGAACTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGTCATCGATTCCCGGGAAAGGGTAGAAGAATGAGACCTATTATGGGACATACAATGCATTACAGATGTATGATCATTACGCTTCAACCGGGTTATTCTATTCCACCTCTTAGAAAGAAAAAAACTTAA ATGCAGACAGAAATAAAACATTGGGTCGAACTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGTCATCGATTCCCGGGAAAGGGTAGAAGAATGAGACCTATTATGGGACATACAATGCATTACAGATGTATGATCATTACGCTTCAACCGGGTTATTCTATTCCACCTCTTAGAAAGAAAAAAACTTAA ATGCAGACAGAAATAAAACATTGGGTCGAACTCTTCTTTGGTGTCAAGGTAATAGCTATGAATAGTCATCGATTCCCGGGAAAGGGTAGAAGAATGAGACCTATTATGGGACATACAATGCATTACAGATGTATGATCATTACGCTTCAACCGGGTTATTCTATTCCACCTCTTAGAAAGAAAAAAACTTAA MQTEIKHWVELFFGVKVIAMNSHRFPGKGRRMRPIMGHTMHYRCMIITLQPGYSIPPLRKKKT
BLAST of Lsi02G010640 vs. Swiss-Prot
Match: RK23_POPAL (50S ribosomal protein L23, chloroplastic OS=Populus alba GN=rpl23-A PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 5.2e-29 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. Swiss-Prot
Match: RK23_VITVI (50S ribosomal protein L23, chloroplastic OS=Vitis vinifera GN=rpl23-A PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.4e-28 Identity = 57/62 (91.94%), Postives = 59/62 (95.16%), Query Frame = 1
BLAST of Lsi02G010640 vs. Swiss-Prot
Match: RK23_JASNU (50S ribosomal protein L23, chloroplastic OS=Jasminum nudiflorum GN=rpl23-A PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.4e-28 Identity = 57/62 (91.94%), Postives = 59/62 (95.16%), Query Frame = 1
BLAST of Lsi02G010640 vs. Swiss-Prot
Match: RK23_COFAR (50S ribosomal protein L23, chloroplastic OS=Coffea arabica GN=rpl23-A PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.4e-28 Identity = 57/62 (91.94%), Postives = 59/62 (95.16%), Query Frame = 1
BLAST of Lsi02G010640 vs. Swiss-Prot
Match: RK23_NANDO (50S ribosomal protein L23, chloroplastic OS=Nandina domestica GN=rpl23-A PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 3.4e-28 Identity = 57/62 (91.94%), Postives = 59/62 (95.16%), Query Frame = 1
BLAST of Lsi02G010640 vs. TrEMBL
Match: A0A0F6WW20_9ROSI (50S ribosomal protein L23, chloroplastic OS=Populus cathayana GN=rpl23 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 5.8e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. TrEMBL
Match: A0A075EDC6_9ROSI (50S ribosomal protein L23, chloroplastic OS=Populus fremontii GN=rpl23 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 5.8e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. TrEMBL
Match: A0A0D4WP24_POPTN (50S ribosomal protein L23, chloroplastic OS=Populus tremula GN=rpl23 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 5.8e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. TrEMBL
Match: A0A023SYR5_9ROSI (50S ribosomal protein L23, chloroplastic OS=Couepia guianensis GN=rpl23 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 5.8e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. TrEMBL
Match: A0A023I0G5_BALVI (50S ribosomal protein L23, chloroplastic OS=Balanops vieillardii GN=rpl23 PE=3 SV=1) HSP 1 Score: 127.5 bits (319), Expect = 5.8e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. TAIR10
Match: ATCG00840.1 (ATCG00840.1 ribosomal protein L23.1) HSP 1 Score: 119.0 bits (297), Expect = 1.0e-27 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 1
BLAST of Lsi02G010640 vs. TAIR10
Match: ATCG01300.1 (ATCG01300.1 ribosomal protein L23) HSP 1 Score: 119.0 bits (297), Expect = 1.0e-27 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 1
BLAST of Lsi02G010640 vs. NCBI nr
Match: gi|984913437|gb|AMC32148.1| (ribosomal protein L23 (chloroplast) [Euphorbia marginata]) HSP 1 Score: 127.5 bits (319), Expect = 8.3e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. NCBI nr
Match: gi|110227121|ref|YP_665600.1| (ribosomal protein L23 [Populus alba]) HSP 1 Score: 127.5 bits (319), Expect = 8.3e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. NCBI nr
Match: gi|817528763|ref|YP_009136643.1| (ribosomal protein L23 (plastid) [Viola seoulensis]) HSP 1 Score: 127.5 bits (319), Expect = 8.3e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. NCBI nr
Match: gi|527354774|gb|AGS12723.1| (ribosomal protein L23 (chloroplast) [Bhesa archboldiana]) HSP 1 Score: 127.5 bits (319), Expect = 8.3e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
BLAST of Lsi02G010640 vs. NCBI nr
Match: gi|326909433|ref|YP_004327723.1| (ribosomal protein L23 [Hevea brasiliensis]) HSP 1 Score: 127.5 bits (319), Expect = 8.3e-27 Identity = 58/62 (93.55%), Postives = 60/62 (96.77%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|