Lsi01G019770 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: five_prime_UTRCDS Hold the cursor over a type above to highlight its positions in the sequence below.CCTTAAGATACAAAGAGAAGCTCTCAGTAATTAGAAAAAGACATGGCTGATATTCCTTTCCCTATTCCTGGTAAGCCTAATTCAAAACCTTTACATCACTTCTCTAAACTAACAACATTTGAAAATTTTGAATCTCATTTTTAAATATATTTATAAATTGAATTGTTTTTTTATAGAAGTTATTACGTTAAAGATCAATATTTGGAGATGAATTGTAGAACTTGTTATAGTGTTAATGGTTGATTGAACATAAAAGATCATACTATTTATTCACTTTTGTCAAACAAATGGCAAATGATGTTTTCGTTTTTAGAAGTGTTTTCATTTAGTTTAATATTTGGAGATGAATCGTAGAACTTGTTATTTATATACTACTAATTTGTTGTAAAGACTTGTTTGGTAGCCAATCTAAAAATATAAATTCAGATTGATTATCAAACACATATTTGTTAAACTAAGTGAATCTGAAAACACGAAACAATATTCAAATTGCCAACTAAATAAATCCTAAATTATTTGTACTAATTAATGAAATATTATTTTGATCCATTAGGAAAATCATCATGGCCAGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA CCTTAAGATACAAAGAGAAGCTCTCAGTAATTAGAAAAAGACATGGCTGATATTCCTTTCCCTATTCCTGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA ATGGCTGATATTCCTTTCCCTATTCCTGAACTTGTGGGAATTGAAGCTGAAATTGCAAAGCTTGTCATACAGAAAGACAATCCTAGAGTGGAAATAATTGACATTATATTAGCCGGTAGTCCAGTGCCTCGTGACTTTAGACAGGATCGAGTTCGAATTTTTGTGAACATACGAAATGTTGCAGTTGAGATACCAATCATTGGTTAA MADIPFPIPELVGIEAEIAKLVIQKDNPRVEIIDIILAGSPVPRDFRQDRVRIFVNIRNVAVEIPIIG
BLAST of Lsi01G019770 vs. Swiss-Prot
Match: ICI1_SOLPE (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum PE=3 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.5e-10 Identity = 32/57 (56.14%), Postives = 42/57 (73.68%), Query Frame = 1
BLAST of Lsi01G019770 vs. Swiss-Prot
Match: ITR1_NICSY (Trypsin inhibitor 1 OS=Nicotiana sylvestris PE=2 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.4e-10 Identity = 28/60 (46.67%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of Lsi01G019770 vs. Swiss-Prot
Match: ICI1_SOLTU (Proteinase inhibitor 1 OS=Solanum tuberosum PE=3 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 1.7e-09 Identity = 28/60 (46.67%), Postives = 42/60 (70.00%), Query Frame = 1
BLAST of Lsi01G019770 vs. Swiss-Prot
Match: ICI1_SOLLC (Wound-induced proteinase inhibitor 1 OS=Solanum lycopersicum GN=PIIF PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 2.9e-09 Identity = 26/59 (44.07%), Postives = 43/59 (72.88%), Query Frame = 1
BLAST of Lsi01G019770 vs. Swiss-Prot
Match: IPIB_TOBAC (Proteinase inhibitor I-B OS=Nicotiana tabacum GN=TIMPA PE=2 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 1.9e-08 Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 1
BLAST of Lsi01G019770 vs. TrEMBL
Match: K4CVX1_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 1.4e-10 Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of Lsi01G019770 vs. TrEMBL
Match: Q40444_9SOLA (Tumor-related protein (Fragment) OS=Nicotiana glauca x Nicotiana langsdorffii PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-09 Identity = 30/60 (50.00%), Postives = 47/60 (78.33%), Query Frame = 1
BLAST of Lsi01G019770 vs. TrEMBL
Match: A0A0A0KME7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G286040 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.0e-09 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Lsi01G019770 vs. TrEMBL
Match: A0A0A0KMM0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_5G285030 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.6e-09 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Lsi01G019770 vs. TrEMBL
Match: M1BHH1_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400017587 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.4e-09 Identity = 31/60 (51.67%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of Lsi01G019770 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 54.3 bits (129), Expect = 3.4e-08 Identity = 28/60 (46.67%), Postives = 38/60 (63.33%), Query Frame = 1
BLAST of Lsi01G019770 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.4 bits (124), Expect = 1.3e-07 Identity = 28/60 (46.67%), Postives = 42/60 (70.00%), Query Frame = 1
BLAST of Lsi01G019770 vs. NCBI nr
Match: gi|460404375|ref|XP_004247658.1| (PREDICTED: wound-induced proteinase inhibitor 1 [Solanum lycopersicum]) HSP 1 Score: 73.2 bits (178), Expect = 2.0e-10 Identity = 36/60 (60.00%), Postives = 45/60 (75.00%), Query Frame = 1
BLAST of Lsi01G019770 vs. NCBI nr
Match: gi|688425|dbj|BAA05472.1| (tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]) HSP 1 Score: 69.7 bits (169), Expect = 2.2e-09 Identity = 30/60 (50.00%), Postives = 47/60 (78.33%), Query Frame = 1
BLAST of Lsi01G019770 vs. NCBI nr
Match: gi|700195663|gb|KGN50840.1| (hypothetical protein Csa_5G286040 [Cucumis sativus]) HSP 1 Score: 69.3 bits (168), Expect = 2.9e-09 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Lsi01G019770 vs. NCBI nr
Match: gi|970057099|ref|XP_015055202.1| (PREDICTED: trypsin inhibitor 1-like [Solanum pennellii]) HSP 1 Score: 68.9 bits (167), Expect = 3.8e-09 Identity = 30/60 (50.00%), Postives = 46/60 (76.67%), Query Frame = 1
BLAST of Lsi01G019770 vs. NCBI nr
Match: gi|700195661|gb|KGN50838.1| (hypothetical protein Csa_5G285030 [Cucumis sativus]) HSP 1 Score: 68.9 bits (167), Expect = 3.8e-09 Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|