Lsi01G019030 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGGCTGGAGTGAGCAATAATAACAAAAATGATGAGAAGGGGTTGCCGGCGGCGGAGAGTGAGATCATAAGAAAGTCAACGCCGCCACCGTTTCTGGTGAAGACTTATACGGCAGTGGAGGATCCAGCGACGGACGAGGTGATATCGTGGAATGGTGACGGGACGGCGTTTGTAGTTTGGCAGACGGCGGAATTCGCTAAAGATGTATTGCCAAAGCTGTTTAAGCATTGCAATTTCTCTAGCTTTGTTCGCCAACTTAATACCTATGTACGCTTTTCTTCTTCTTTACCTATTTTATTTAATTCATTACATTATTTATCTTAG ATGGAGGCTGGAGTGAGCAATAATAACAAAAATGATGAGAAGGGGTTGCCGGCGGCGGAGAGTGAGATCATAAGAAAGTCAACGCCGCCACCGTTTCTGGTGAAGACTTATACGGCAGTGGAGGATCCAGCGACGGACGAGGTGATATCGTGGAATGGTGACGGGACGGCGTTTGTAGTTTGGCAGACGGCGGAATTCGCTAAAGATGTATTGCCAAAGCTGTTTAAGCATTGCAATTTCTCTAGCTTTGTTCGCCAACTTAATACCTATGTACGCTTTTCTTCTTCTTTACCTATTTTATTTAATTCATTACATTATTTATCTTAG ATGGAGGCTGGAGTGAGCAATAATAACAAAAATGATGAGAAGGGGTTGCCGGCGGCGGAGAGTGAGATCATAAGAAAGTCAACGCCGCCACCGTTTCTGGTGAAGACTTATACGGCAGTGGAGGATCCAGCGACGGACGAGGTGATATCGTGGAATGGTGACGGGACGGCGTTTGTAGTTTGGCAGACGGCGGAATTCGCTAAAGATGTATTGCCAAAGCTGTTTAAGCATTGCAATTTCTCTAGCTTTGTTCGCCAACTTAATACCTATGTACGCTTTTCTTCTTCTTTACCTATTTTATTTAATTCATTACATTATTTATCTTAG MEAGVSNNNKNDEKGLPAAESEIIRKSTPPPFLVKTYTAVEDPATDEVISWNGDGTAFVVWQTAEFAKDVLPKLFKHCNFSSFVRQLNTYVRFSSSLPILFNSLHYLS
BLAST of Lsi01G019030 vs. Swiss-Prot
Match: HSFB3_ARATH (Heat stress transcription factor B-3 OS=Arabidopsis thaliana GN=HSFB3 PE=2 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 1.2e-25 Identity = 58/89 (65.17%), Postives = 63/89 (70.79%), Query Frame = 1
BLAST of Lsi01G019030 vs. Swiss-Prot
Match: HFB2C_ORYSJ (Heat stress transcription factor B-2c OS=Oryza sativa subsp. japonica GN=HSFB2C PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.3e-23 Identity = 51/73 (69.86%), Postives = 59/73 (80.82%), Query Frame = 1
BLAST of Lsi01G019030 vs. Swiss-Prot
Match: HFB2A_ORYSJ (Heat stress transcription factor B-2a OS=Oryza sativa subsp. japonica GN=HSFB2A PE=2 SV=2) HSP 1 Score: 107.1 bits (266), Expect = 1.2e-22 Identity = 48/61 (78.69%), Postives = 52/61 (85.25%), Query Frame = 1
BLAST of Lsi01G019030 vs. Swiss-Prot
Match: HFB2B_ORYSJ (Heat stress transcription factor B-2b OS=Oryza sativa subsp. japonica GN=HSFB2B PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.1e-22 Identity = 50/79 (63.29%), Postives = 61/79 (77.22%), Query Frame = 1
BLAST of Lsi01G019030 vs. Swiss-Prot
Match: HSF24_SOLPE (Heat shock factor protein HSF24 OS=Solanum peruvianum GN=HSF24 PE=2 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.6e-22 Identity = 48/66 (72.73%), Postives = 56/66 (84.85%), Query Frame = 1
BLAST of Lsi01G019030 vs. TrEMBL
Match: A0A0A0KYD7_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G171490 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 5.4e-33 Identity = 82/107 (76.64%), Postives = 89/107 (83.18%), Query Frame = 1
BLAST of Lsi01G019030 vs. TrEMBL
Match: A0A067K1D9_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_21103 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 59/85 (69.41%), Postives = 69/85 (81.18%), Query Frame = 1
BLAST of Lsi01G019030 vs. TrEMBL
Match: A0A059DIB7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_A02338 PE=3 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 3.8e-26 Identity = 60/80 (75.00%), Postives = 68/80 (85.00%), Query Frame = 1
BLAST of Lsi01G019030 vs. TrEMBL
Match: V4LQK3_EUTSA (Uncharacterized protein OS=Eutrema salsugineum GN=EUTSA_v10017795mg PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.9e-26 Identity = 61/92 (66.30%), Postives = 68/92 (73.91%), Query Frame = 1
BLAST of Lsi01G019030 vs. TrEMBL
Match: A0A0U3SRJ2_VITPS (Transcription factor HsfB3a OS=Vitis pseudoreticulata PE=2 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 4.9e-26 Identity = 61/78 (78.21%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of Lsi01G019030 vs. TAIR10
Match: AT2G41690.1 (AT2G41690.1 heat shock transcription factor B3) HSP 1 Score: 117.1 bits (292), Expect = 6.8e-27 Identity = 58/89 (65.17%), Postives = 63/89 (70.79%), Query Frame = 1
BLAST of Lsi01G019030 vs. TAIR10
Match: AT4G11660.1 (AT4G11660.1 winged-helix DNA-binding transcription factor family protein) HSP 1 Score: 105.5 bits (262), Expect = 2.0e-23 Identity = 47/66 (71.21%), Postives = 54/66 (81.82%), Query Frame = 1
BLAST of Lsi01G019030 vs. TAIR10
Match: AT4G36990.1 (AT4G36990.1 heat shock factor 4) HSP 1 Score: 105.1 bits (261), Expect = 2.7e-23 Identity = 46/66 (69.70%), Postives = 57/66 (86.36%), Query Frame = 1
BLAST of Lsi01G019030 vs. TAIR10
Match: AT1G46264.1 (AT1G46264.1 heat shock transcription factor B4) HSP 1 Score: 99.4 bits (246), Expect = 1.5e-21 Identity = 44/65 (67.69%), Postives = 50/65 (76.92%), Query Frame = 1
BLAST of Lsi01G019030 vs. TAIR10
Match: AT5G62020.1 (AT5G62020.1 heat shock transcription factor B2A) HSP 1 Score: 98.2 bits (243), Expect = 3.3e-21 Identity = 43/66 (65.15%), Postives = 53/66 (80.30%), Query Frame = 1
BLAST of Lsi01G019030 vs. NCBI nr
Match: gi|700198701|gb|KGN53859.1| (hypothetical protein Csa_4G171490 [Cucumis sativus]) HSP 1 Score: 148.3 bits (373), Expect = 7.8e-33 Identity = 82/107 (76.64%), Postives = 89/107 (83.18%), Query Frame = 1
BLAST of Lsi01G019030 vs. NCBI nr
Match: gi|449463360|ref|XP_004149402.1| (PREDICTED: heat stress transcription factor B-3 [Cucumis sativus]) HSP 1 Score: 141.0 bits (354), Expect = 1.2e-30 Identity = 75/98 (76.53%), Postives = 82/98 (83.67%), Query Frame = 1
BLAST of Lsi01G019030 vs. NCBI nr
Match: gi|659121625|ref|XP_008460754.1| (PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor B-3 [Cucumis melo]) HSP 1 Score: 139.8 bits (351), Expect = 2.8e-30 Identity = 74/98 (75.51%), Postives = 81/98 (82.65%), Query Frame = 1
BLAST of Lsi01G019030 vs. NCBI nr
Match: gi|802729186|ref|XP_012086190.1| (PREDICTED: heat stress transcription factor B-3 [Jatropha curcas]) HSP 1 Score: 127.1 bits (318), Expect = 1.9e-26 Identity = 59/85 (69.41%), Postives = 69/85 (81.18%), Query Frame = 1
BLAST of Lsi01G019030 vs. NCBI nr
Match: gi|702247598|ref|XP_010056944.1| (PREDICTED: heat stress transcription factor B-3 [Eucalyptus grandis]) HSP 1 Score: 125.6 bits (314), Expect = 5.4e-26 Identity = 60/80 (75.00%), Postives = 68/80 (85.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|