Lsi01G008100 (gene) Bottle gourd (USVL1VR-Ls)
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGCATGCAGTCGGCCGAGTTGATGGATGAGAATAAGCGACTGAAACAACAAGTAAGAAGAACCCTTTTCCACAGCATACTAATATAAATTGTGTCCTTTAAATCCCTTTGTAACTTTCGGCGGCGGTGGTTTGCAGGCGGAGAAAATGAACGCCGTGAGGCACCTGGGCGTTGAGCCCGAGATTTTGGTCGTGGAAGATGGCCAGTCGTCGAACTCCGTCACTGAAGCTTGTGTCTCCAATTCCAATGGCCCGCCTCAAGATCTGGAAAGCTCAGACACATCTCTGAAACTAGGGTATCTCTTCATTTCATGA ATGTGCATGCAGTCGGCCGAGTTGATGGATGAGAATAAGCGACTGAAACAACAAGCGGAGAAAATGAACGCCGTGAGGCACCTGGGCGTTGAGCCCGAGATTTTGGTCGTGGAAGATGGCCAGTCGTCGAACTCCGTCACTGAAGCTTGTGTCTCCAATTCCAATGGCCCGCCTCAAGATCTGGAAAGCTCAGACACATCTCTGAAACTAGGGTATCTCTTCATTTCATGA ATGTGCATGCAGTCGGCCGAGTTGATGGATGAGAATAAGCGACTGAAACAACAAGCGGAGAAAATGAACGCCGTGAGGCACCTGGGCGTTGAGCCCGAGATTTTGGTCGTGGAAGATGGCCAGTCGTCGAACTCCGTCACTGAAGCTTGTGTCTCCAATTCCAATGGCCCGCCTCAAGATCTGGAAAGCTCAGACACATCTCTGAAACTAGGGTATCTCTTCATTTCATGA MCMQSAELMDENKRLKQQAEKMNAVRHLGVEPEILVVEDGQSSNSVTEACVSNSNGPPQDLESSDTSLKLGYLFIS
BLAST of Lsi01G008100 vs. Swiss-Prot
Match: SVP_ARATH (MADS-box protein SVP OS=Arabidopsis thaliana GN=SVP PE=1 SV=1) HSP 1 Score: 54.7 bits (130), Expect = 5.2e-07 Identity = 38/79 (48.10%), Postives = 45/79 (56.96%), Query Frame = 1
BLAST of Lsi01G008100 vs. TrEMBL
Match: A0A0A0KIR9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_6G499000 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 9.1e-27 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Lsi01G008100 vs. TrEMBL
Match: A0A0H3U1Y8_PAESU (SVP OS=Paeonia suffruticosa PE=2 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 9.2e-11 Identity = 37/68 (54.41%), Postives = 49/68 (72.06%), Query Frame = 1
BLAST of Lsi01G008100 vs. TrEMBL
Match: E3NYP9_SOYBN (Short vegetative phase-like protein OS=Glycine max GN=SVPL PE=2 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.9e-09 Identity = 40/65 (61.54%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of Lsi01G008100 vs. TrEMBL
Match: A0A0B2NY65_GLYSO (MADS-box protein SVP OS=Glycine soja GN=glysoja_000085 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.9e-09 Identity = 40/65 (61.54%), Postives = 47/65 (72.31%), Query Frame = 1
BLAST of Lsi01G008100 vs. TrEMBL
Match: F6M3V2_BETPL (MADS-box protein (Fragment) OS=Betula platyphylla GN=MADS14 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 5.0e-09 Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 1
BLAST of Lsi01G008100 vs. TAIR10
Match: AT2G22540.1 (AT2G22540.1 K-box region and MADS-box transcription factor family protein ) HSP 1 Score: 54.7 bits (130), Expect = 2.9e-08 Identity = 38/79 (48.10%), Postives = 45/79 (56.96%), Query Frame = 1
BLAST of Lsi01G008100 vs. NCBI nr
Match: gi|449451385|ref|XP_004143442.1| (PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Lsi01G008100 vs. NCBI nr
Match: gi|778719004|ref|XP_011657948.1| (PREDICTED: MADS-box protein SVP-like isoform X2 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Lsi01G008100 vs. NCBI nr
Match: gi|700193500|gb|KGN48704.1| (hypothetical protein Csa_6G499000 [Cucumis sativus]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Lsi01G008100 vs. NCBI nr
Match: gi|659079967|ref|XP_008440541.1| (PREDICTED: MADS-box protein SVP-like isoform X2 [Cucumis melo]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
BLAST of Lsi01G008100 vs. NCBI nr
Match: gi|659079963|ref|XP_008440538.1| (PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis melo]) HSP 1 Score: 127.1 bits (318), Expect = 1.3e-26 Identity = 65/68 (95.59%), Postives = 66/68 (97.06%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of Lagenaria siceraria
Date Performed: 2017-09-18
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |