Cucsa.375250 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGCAGCGTCTTACATACCGCAAGCGCCATAACTATGCTACCAAGTCTAACCAGCACTGTGTCGTTAAAACCCCTGGTGTGAAGCACGTGTATCTGACTGCCAAGAAAAGTGCTAGCAGACCTAATAAGGTTATCGGCAAAAGGATTCAAGGGATTTCTCACTTGAGGCCAGCTAAATATAAGAGGACTAGACTAGCTAGGAATTGGAGGATTGTGAATCGTGCGTATGATGGCGTTTTATCTAGTAGTGCAGTGAGGGAGAGGATTATTCGAGCCTTTTTGGTTGAAGGGCAGAAGATTGTGAAGC ATGGTGCAGCGTCTTACATACCGCAAGCGCCATAACTATGCTACCAAGTCTAACCAGCACTGTGTCGTTAAAACCCCTGGTGTGAAGCACGTGTATCTGACTGCCAAGAAAAGTGCTAGCAGACCTAATAAGGTTATCGGCAAAAGGATTCAAGGGATTTCTCACTTGAGGCCAGCTAAATATAAGAGGACTAGACTAGCTAGGAATTGGAGGATTGTGAATCGTGCGTATGATGGCGTTTTATCTAGTAGTGCAGTGAGGGAGAGGATTATTCGAGCCTTTTTGGTTGAAGGGCAGAAGATTGTGAAGC ATGGTGCAGCGTCTTACATACCGCAAGCGCCATAACTATGCTACCAAGTCTAACCAGCACTGTGTCGTTAAAACCCCTGGTGTGAAGCACGTGTATCTGACTGCCAAGAAAAGTGCTAGCAGACCTAATAAGGTTATCGGCAAAAGGATTCAAGGGATTTCTCACTTGAGGCCAGCTAAATATAAGAGGACTAGACTAGCTAGGAATTGGAGGATTGTGAATCGTGCGTATGATGGCGTTTTATCTAGTAGTGCAGTGAGGGAGAGGATTATTCGAGCCTTTTTGGTTGAAGGGCAGAAGATTGTGAAGC MVQRLTYRKRHNYATKSNQHCVVKTPGVKHVYLTAKKSASRPNKVIGKRIQGISHLRPAKYKRTRLARNWRIVNRAYDGVLSSSAVRERIIRAFLVEGQKIVKX
BLAST of Cucsa.375250 vs. Swiss-Prot
Match: RL34_TOBAC (60S ribosomal protein L34 OS=Nicotiana tabacum GN=RPL34 PE=2 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.6e-35 Identity = 80/104 (76.92%), Postives = 86/104 (82.69%), Query Frame = 1
BLAST of Cucsa.375250 vs. Swiss-Prot
Match: RL34_PEA (60S ribosomal protein L34 OS=Pisum sativum GN=RPL34 PE=2 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 2.8e-35 Identity = 80/104 (76.92%), Postives = 85/104 (81.73%), Query Frame = 1
BLAST of Cucsa.375250 vs. Swiss-Prot
Match: RL341_ARATH (60S ribosomal protein L34-1 OS=Arabidopsis thaliana GN=RPL34A PE=2 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 6.1e-35 Identity = 79/104 (75.96%), Postives = 85/104 (81.73%), Query Frame = 1
BLAST of Cucsa.375250 vs. Swiss-Prot
Match: RL342_ARATH (60S ribosomal protein L34-2 OS=Arabidopsis thaliana GN=RPL34B PE=3 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 2.3e-34 Identity = 78/104 (75.00%), Postives = 83/104 (79.81%), Query Frame = 1
BLAST of Cucsa.375250 vs. Swiss-Prot
Match: RL343_ARATH (60S ribosomal protein L34-3 OS=Arabidopsis thaliana GN=RPL34C PE=2 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 8.9e-34 Identity = 77/104 (74.04%), Postives = 82/104 (78.85%), Query Frame = 1
BLAST of Cucsa.375250 vs. TrEMBL
Match: A0A0A0LK03_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_2G338890 PE=4 SV=1) HSP 1 Score: 154.5 bits (389), Expect = 7.3e-35 Identity = 84/104 (80.77%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. TrEMBL
Match: A9P8R1_POPTR (Ribosomal protein L34 OS=Populus trichocarpa GN=POPTR_0012s11020g PE=2 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.6e-34 Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. TrEMBL
Match: A0A0A0LP37_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G009690 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.6e-34 Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. TrEMBL
Match: A9PDF8_POPTR (Ribosomal protein L34 OS=Populus trichocarpa GN=POPTR_0017s11850g PE=2 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.6e-34 Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. TrEMBL
Match: A9PB27_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0015s11780g PE=2 SV=1) HSP 1 Score: 152.9 bits (385), Expect = 2.1e-34 Identity = 82/104 (78.85%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. TAIR10
Match: AT1G26880.1 (AT1G26880.1 Ribosomal protein L34e superfamily protein) HSP 1 Score: 147.9 bits (372), Expect = 3.5e-36 Identity = 79/104 (75.96%), Postives = 85/104 (81.73%), Query Frame = 1
BLAST of Cucsa.375250 vs. TAIR10
Match: AT1G69620.1 (AT1G69620.1 ribosomal protein L34) HSP 1 Score: 146.0 bits (367), Expect = 1.3e-35 Identity = 78/104 (75.00%), Postives = 83/104 (79.81%), Query Frame = 1
BLAST of Cucsa.375250 vs. TAIR10
Match: AT3G28900.1 (AT3G28900.1 Ribosomal protein L34e superfamily protein) HSP 1 Score: 144.1 bits (362), Expect = 5.0e-35 Identity = 77/104 (74.04%), Postives = 82/104 (78.85%), Query Frame = 1
BLAST of Cucsa.375250 vs. NCBI nr
Match: gi|449459176|ref|XP_004147322.1| (PREDICTED: 60S ribosomal protein L34 [Cucumis sativus]) HSP 1 Score: 154.5 bits (389), Expect = 1.0e-34 Identity = 84/104 (80.77%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. NCBI nr
Match: gi|224141383|ref|XP_002324052.1| (ribosomal protein L34 [Populus trichocarpa]) HSP 1 Score: 153.3 bits (386), Expect = 2.3e-34 Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. NCBI nr
Match: gi|743894063|ref|XP_011040278.1| (PREDICTED: 60S ribosomal protein L34-like [Populus euphratica]) HSP 1 Score: 153.3 bits (386), Expect = 2.3e-34 Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. NCBI nr
Match: gi|778655948|ref|XP_004138165.2| (PREDICTED: 60S ribosomal protein L34-like [Cucumis sativus]) HSP 1 Score: 153.3 bits (386), Expect = 2.3e-34 Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 1
BLAST of Cucsa.375250 vs. NCBI nr
Match: gi|224122214|ref|XP_002318779.1| (ribosomal protein L34 [Populus trichocarpa]) HSP 1 Score: 153.3 bits (386), Expect = 2.3e-34 Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|