Cucsa.356570 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GTTGAAAGAGAGAGAAATTTACTTAATTCTAAGTTAGCCGAGTTTGAGGGCCTTCTTCTTAAGCCATATGTAACACCATCAAATCGTGCTCCTGGCAACCAAAGCTCATTTTCAGGAACTAATTCTCCTTCAATTCTACCAAGTGCTCAAAATAACACTCCTTCGTTGTCAAGTTTTAGCCAGTTGGGTGCATCACTTAATACAGGATTTGGTGCTAG GTTGAAAGAGAGAGAAATTTACTTAATTCTAAGTTAGCCGAGTTTGAGGGCCTTCTTCTTAAGCCATATGTAACACCATCAAATCGTGCTCCTGGCAACCAAAGCTCATTTTCAGGAACTAATTCTCCTTCAATTCTACCAAGTGCTCAAAATAACACTCCTTCGTTGTCAAGTTTTAGCCAGTTGGGTGCATCACTTAATACAGGATTTGGTGCTAG GTTGAAAGAGAGAGAAATTTACTTAATTCTAAGTTAGCCGAGTTTGAGGGCCTTCTTCTTAAGCCATATGTAACACCATCAAATCGTGCTCCTGGCAACCAAAGCTCATTTTCAGGAACTAATTCTCCTTCAATTCTACCAAGTGCTCAAAATAACACTCCTTCGTTGTCAAGTTTTAGCCAGTTGGGTGCATCACTTAATACAGGATTTGGTGCTAG VERERNLLNSKLAEFEGLLLKPYVTPSNRAPGNQSSFSGTNSPSILPSAQNNTPSLSSFSQLGASLNTGFGAX
BLAST of Cucsa.356570 vs. Swiss-Prot
Match: C3H16_ARATH (Zinc finger CCCH domain-containing protein 16 OS=Arabidopsis thaliana GN=CG1 PE=1 SV=2) HSP 1 Score: 55.8 bits (133), Expect = 2.2e-07 Identity = 38/74 (51.35%), Postives = 44/74 (59.46%), Query Frame = 1
BLAST of Cucsa.356570 vs. TrEMBL
Match: A0A067K7I7_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_19788 PE=4 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.8e-11 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 1
BLAST of Cucsa.356570 vs. TrEMBL
Match: B9RL60_RICCO (Nucleic acid binding protein, putative OS=Ricinus communis GN=RCOM_1667360 PE=4 SV=1) HSP 1 Score: 75.9 bits (185), Expect = 2.3e-11 Identity = 44/68 (64.71%), Postives = 48/68 (70.59%), Query Frame = 1
BLAST of Cucsa.356570 vs. TrEMBL
Match: A0A0D2TGB1_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G009900 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.0e-11 Identity = 41/77 (53.25%), Postives = 47/77 (61.04%), Query Frame = 1
BLAST of Cucsa.356570 vs. TrEMBL
Match: A0A0D2V082_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G009900 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.0e-11 Identity = 41/77 (53.25%), Postives = 47/77 (61.04%), Query Frame = 1
BLAST of Cucsa.356570 vs. TrEMBL
Match: A0A0D2RVL9_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_012G009900 PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.0e-11 Identity = 41/77 (53.25%), Postives = 47/77 (61.04%), Query Frame = 1
BLAST of Cucsa.356570 vs. TAIR10
Match: AT1G75340.1 (AT1G75340.1 Zinc finger C-x8-C-x5-C-x3-H type family protein) HSP 1 Score: 55.8 bits (133), Expect = 1.3e-08 Identity = 38/74 (51.35%), Postives = 44/74 (59.46%), Query Frame = 1
BLAST of Cucsa.356570 vs. NCBI nr
Match: gi|778664070|ref|XP_011660211.1| (PREDICTED: zinc finger CCCH domain-containing protein 16 isoform X1 [Cucumis sativus]) HSP 1 Score: 143.7 bits (361), Expect = 1.3e-31 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 1
BLAST of Cucsa.356570 vs. NCBI nr
Match: gi|778664073|ref|XP_011660212.1| (PREDICTED: zinc finger CCCH domain-containing protein 16 isoform X2 [Cucumis sativus]) HSP 1 Score: 143.7 bits (361), Expect = 1.3e-31 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 1
BLAST of Cucsa.356570 vs. NCBI nr
Match: gi|659085904|ref|XP_008443668.1| (PREDICTED: zinc finger CCCH domain-containing protein 16 isoform X2 [Cucumis melo]) HSP 1 Score: 141.0 bits (354), Expect = 8.4e-31 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
BLAST of Cucsa.356570 vs. NCBI nr
Match: gi|659085902|ref|XP_008443667.1| (PREDICTED: zinc finger CCCH domain-containing protein 16 isoform X1 [Cucumis melo]) HSP 1 Score: 141.0 bits (354), Expect = 8.4e-31 Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 1
BLAST of Cucsa.356570 vs. NCBI nr
Match: gi|802707364|ref|XP_012084301.1| (PREDICTED: zinc finger CCCH domain-containing protein 16 isoform X1 [Jatropha curcas]) HSP 1 Score: 76.3 bits (186), Expect = 2.5e-11 Identity = 44/72 (61.11%), Postives = 49/72 (68.06%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|