Cucsa.340080 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CTGTGGTTGAAATGTGGCAGCATAGTTAATCCTATGAAAGTATTTAGAGAAATGAAAGTAAAAGAAATAGTTACCTTCGCGAGAATGGCAGGTTGTAGAGTCCAGGGACAAGGAAGAAAAGAGTTGAAACCGTTTGACAAAATGATAGAGATGTCAGAAGTTATGCCCAACCAAGAAACATTTCTCTCATTGTTATCTGCTTGTAGCCATGGCGGTTTATTGAAGAGTGGATAA CTGTGGTTGAAATGTGGCAGCATAGTTAATCCTATGAAAGTATTTAGAGAAATGAAAGTAAAAGAAATAGTTACCTTCGCGAGAATGGCAGGTTGTAGAGTCCAGGGACAAGGAAGAAAAGAGTTGAAACCGTTTGACAAAATGATAGAGATGTCAGAAGTTATGCCCAACCAAGAAACATTTCTCTCATTGTTATCTGCTTGTAGCCATGGCGGTTTATTGAAGAGTGGATAA CTGTGGTTGAAATGTGGCAGCATAGTTAATCCTATGAAAGTATTTAGAGAAATGAAAGTAAAAGAAATAGTTACCTTCGCGAGAATGGCAGGTTGTAGAGTCCAGGGACAAGGAAGAAAAGAGTTGAAACCGTTTGACAAAATGATAGAGATGTCAGAAGTTATGCCCAACCAAGAAACATTTCTCTCATTGTTATCTGCTTGTAGCCATGGCGGTTTATTGAAGAGTGGATAA LWLKCGSIVNPMKVFREMKVKEIVTFARMAGCRVQGQGRKELKPFDKMIEMSEVMPNQETFLSLLSACSHGGLLKSG*
BLAST of Cucsa.340080 vs. Swiss-Prot
Match: PP205_ARATH (Putative pentatricopeptide repeat-containing protein At3g01580 OS=Arabidopsis thaliana GN=PCMP-E87 PE=3 SV=2) HSP 1 Score: 72.8 bits (177), Expect = 1.9e-12 Identity = 35/78 (44.87%), Postives = 52/78 (66.67%), Query Frame = 1
HSP 2 Score: 47.8 bits (112), Expect = 6.5e-05 Identity = 21/70 (30.00%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Cucsa.340080 vs. Swiss-Prot
Match: PP286_ARATH (Pentatricopeptide repeat-containing protein At3g58590 OS=Arabidopsis thaliana GN=At3g58590 PE=2 SV=2) HSP 1 Score: 60.8 bits (146), Expect = 7.4e-09 Identity = 28/75 (37.33%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Cucsa.340080 vs. Swiss-Prot
Match: PP386_ARATH (Pentatricopeptide repeat-containing protein At5g15340, mitochondrial OS=Arabidopsis thaliana GN=PCMP-H91 PE=2 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 7.4e-09 Identity = 32/78 (41.03%), Postives = 50/78 (64.10%), Query Frame = 1
BLAST of Cucsa.340080 vs. Swiss-Prot
Match: PP448_ARATH (Pentatricopeptide repeat-containing protein At5g66500, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E38 PE=2 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.8e-08 Identity = 33/76 (43.42%), Postives = 45/76 (59.21%), Query Frame = 1
BLAST of Cucsa.340080 vs. Swiss-Prot
Match: PP284_ARATH (Pentatricopeptide repeat-containing protein At3g56550 OS=Arabidopsis thaliana GN=PCMP-H80 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 3.7e-08 Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
BLAST of Cucsa.340080 vs. TrEMBL
Match: A0A0A0LFK2_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G840360 PE=4 SV=1) HSP 1 Score: 101.3 bits (251), Expect = 5.5e-19 Identity = 52/78 (66.67%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of Cucsa.340080 vs. TrEMBL
Match: A0A118K5K9_CYNCS (Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus GN=Ccrd_012361 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.8e-12 Identity = 37/75 (49.33%), Postives = 55/75 (73.33%), Query Frame = 1
BLAST of Cucsa.340080 vs. TrEMBL
Match: A0A118K5K9_CYNCS (Pentatricopeptide repeat-containing protein OS=Cynara cardunculus var. scolymus GN=Ccrd_012361 PE=4 SV=1) HSP 1 Score: 43.1 bits (100), Expect = 1.8e-01 Identity = 25/77 (32.47%), Postives = 41/77 (53.25%), Query Frame = 1
HSP 2 Score: 75.9 bits (185), Expect = 2.5e-11 Identity = 36/78 (46.15%), Postives = 55/78 (70.51%), Query Frame = 1
BLAST of Cucsa.340080 vs. TrEMBL
Match: A0A0D3B993_BRAOL (Oleosin OS=Brassica oleracea var. oleracea PE=3 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.2e-11 Identity = 36/78 (46.15%), Postives = 54/78 (69.23%), Query Frame = 1
BLAST of Cucsa.340080 vs. TrEMBL
Match: A0A078DRM6_BRANA (BnaC03g32430D protein OS=Brassica napus GN=BnaC03g32430D PE=4 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 4.2e-11 Identity = 36/78 (46.15%), Postives = 54/78 (69.23%), Query Frame = 1
BLAST of Cucsa.340080 vs. TAIR10
Match: AT3G01580.1 (AT3G01580.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 72.8 bits (177), Expect = 1.1e-13 Identity = 35/78 (44.87%), Postives = 52/78 (66.67%), Query Frame = 1
HSP 2 Score: 47.8 bits (112), Expect = 3.7e-06 Identity = 21/70 (30.00%), Postives = 47/70 (67.14%), Query Frame = 1
BLAST of Cucsa.340080 vs. TAIR10
Match: AT3G58590.1 (AT3G58590.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 4.2e-10 Identity = 28/75 (37.33%), Postives = 49/75 (65.33%), Query Frame = 1
BLAST of Cucsa.340080 vs. TAIR10
Match: AT5G15340.1 (AT5G15340.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 60.8 bits (146), Expect = 4.2e-10 Identity = 32/78 (41.03%), Postives = 50/78 (64.10%), Query Frame = 1
BLAST of Cucsa.340080 vs. TAIR10
Match: AT5G66500.1 (AT5G66500.1 Tetratricopeptide repeat (TPR)-like superfamily protein) HSP 1 Score: 58.9 bits (141), Expect = 1.6e-09 Identity = 33/76 (43.42%), Postives = 45/76 (59.21%), Query Frame = 1
BLAST of Cucsa.340080 vs. TAIR10
Match: AT3G56550.1 (AT3G56550.1 Pentatricopeptide repeat (PPR) superfamily protein) HSP 1 Score: 58.5 bits (140), Expect = 2.1e-09 Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1
BLAST of Cucsa.340080 vs. NCBI nr
Match: gi|659129955|ref|XP_008464928.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Cucumis melo]) HSP 1 Score: 104.0 bits (258), Expect = 1.2e-19 Identity = 53/78 (67.95%), Postives = 65/78 (83.33%), Query Frame = 1
BLAST of Cucsa.340080 vs. NCBI nr
Match: gi|778685923|ref|XP_011652303.1| (PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Cucumis sativus]) HSP 1 Score: 101.3 bits (251), Expect = 7.9e-19 Identity = 52/78 (66.67%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of Cucsa.340080 vs. NCBI nr
Match: gi|700204576|gb|KGN59709.1| (hypothetical protein Csa_3G840360 [Cucumis sativus]) HSP 1 Score: 101.3 bits (251), Expect = 7.9e-19 Identity = 52/78 (66.67%), Postives = 64/78 (82.05%), Query Frame = 1
BLAST of Cucsa.340080 vs. NCBI nr
Match: gi|976925348|gb|KVI09257.1| (Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus]) HSP 1 Score: 78.6 bits (192), Expect = 5.5e-12 Identity = 37/75 (49.33%), Postives = 55/75 (73.33%), Query Frame = 1
BLAST of Cucsa.340080 vs. NCBI nr
Match: gi|976925348|gb|KVI09257.1| (Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus]) HSP 1 Score: 43.1 bits (100), Expect = 2.6e-01 Identity = 25/77 (32.47%), Postives = 41/77 (53.25%), Query Frame = 1
HSP 2 Score: 77.8 bits (190), Expect = 9.4e-12 Identity = 41/78 (52.56%), Postives = 55/78 (70.51%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |