Cucsa.319450 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGAATAGTGATGAGAATGATGTAATTGATTGAATGTTCCATCTTATGTGCAGTCCTATGGGATAAAAGTTGGATATGGTGGAATCCCAGGGCCATCAGGAGGCAGAGATGGTGCTACAGCTCAATCTGGGGGTTGTTGCAGTTAA ATGAATAGTGATGAGAATGATTCCTATGGGATAAAAGTTGGATATGGTGGAATCCCAGGGCCATCAGGAGGCAGAGATGGTGCTACAGCTCAATCTGGGGGTTGTTGCAGTTAA ATGAATAGTGATGAGAATGATTCCTATGGGATAAAAGTTGGATATGGTGGAATCCCAGGGCCATCAGGAGGCAGAGATGGTGCTACAGCTCAATCTGGGGGTTGTTGCAGTTAA MNSDENDSYGIKVGYGGIPGPSGGRDGATAQSGGCCS*
BLAST of Cucsa.319450 vs. Swiss-Prot
Match: RAB1C_ARATH (Ras-related protein RABB1c OS=Arabidopsis thaliana GN=RABB1C PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.0e-11 Identity = 27/31 (87.10%), Postives = 30/31 (96.77%), Query Frame = 1
BLAST of Cucsa.319450 vs. TrEMBL
Match: A0A0A0LYF8_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G172570 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.3e-10 Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = 1
BLAST of Cucsa.319450 vs. TrEMBL
Match: A0A068UD81_COFCA (Uncharacterized protein OS=Coffea canephora GN=GSCOC_T00021537001 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 1.5e-09 Identity = 29/32 (90.62%), Postives = 30/32 (93.75%), Query Frame = 1
BLAST of Cucsa.319450 vs. TrEMBL
Match: A9PGF6_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0006s00360g PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 2.5e-09 Identity = 28/32 (87.50%), Postives = 31/32 (96.88%), Query Frame = 1
BLAST of Cucsa.319450 vs. TrEMBL
Match: U6C2W4_NICAL (Predicted Rab2 GTPase ortholog (Fragment) OS=Nicotiana alata GN=NaRAB2 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 3.3e-09 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 1
BLAST of Cucsa.319450 vs. TrEMBL
Match: Q946G3_TOBAC (Small GTPase Rab2 OS=Nicotiana tabacum GN=Rab2 PE=2 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 3.3e-09 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 1
BLAST of Cucsa.319450 vs. TAIR10
Match: AT4G17170.1 (AT4G17170.1 RAB GTPase homolog B1C) HSP 1 Score: 67.0 bits (162), Expect = 2.8e-12 Identity = 27/31 (87.10%), Postives = 30/31 (96.77%), Query Frame = 1
BLAST of Cucsa.319450 vs. TAIR10
Match: AT4G35860.1 (AT4G35860.1 GTP-binding 2) HSP 1 Score: 48.1 bits (113), Expect = 1.4e-06 Identity = 19/31 (61.29%), Postives = 23/31 (74.19%), Query Frame = 1
BLAST of Cucsa.319450 vs. NCBI nr
Match: gi|449443494|ref|XP_004139512.1| (PREDICTED: ras-related protein RABB1c [Cucumis sativus]) HSP 1 Score: 72.4 bits (176), Expect = 1.9e-10 Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = 1
BLAST of Cucsa.319450 vs. NCBI nr
Match: gi|661890647|emb|CDP06144.1| (unnamed protein product [Coffea canephora]) HSP 1 Score: 68.9 bits (167), Expect = 2.1e-09 Identity = 29/32 (90.62%), Postives = 30/32 (93.75%), Query Frame = 1
BLAST of Cucsa.319450 vs. NCBI nr
Match: gi|657984461|ref|XP_008384325.1| (PREDICTED: ras-related protein RABB1c [Malus domestica]) HSP 1 Score: 68.6 bits (166), Expect = 2.8e-09 Identity = 28/32 (87.50%), Postives = 32/32 (100.00%), Query Frame = 1
BLAST of Cucsa.319450 vs. NCBI nr
Match: gi|224089509|ref|XP_002308739.1| (hypothetical protein POPTR_0006s00360g [Populus trichocarpa]) HSP 1 Score: 68.2 bits (165), Expect = 3.6e-09 Identity = 28/32 (87.50%), Postives = 31/32 (96.88%), Query Frame = 1
BLAST of Cucsa.319450 vs. NCBI nr
Match: gi|553726739|dbj|BAO02541.1| (predicted Rab2 GTPase ortholog, partial [Nicotiana alata]) HSP 1 Score: 67.8 bits (164), Expect = 4.7e-09 Identity = 28/32 (87.50%), Postives = 30/32 (93.75%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|