Cucsa.318770 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAACGTCCCGGTCGAAATATGGCTTTCAAATTCAGTTCCGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACGTAAAAAGGAAGAGACTCATAGAATCTATATATTGATAATAAAAAATTATATTACATATAAAGTGAAAACTAAAGCATTGCAATGAAATACATTACACATATCCTTAACAATAAGAATATAAAAACTAACCTATCTATTGCAACATGTTTCTATGGTCTACAGATTCTTTGGAAACATGCAAAATCACAGTGAATGAATGGTAA TTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAACGTCCCGGTCGAAATATGGCTTTCAAATTCAGTTCCGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACATTCTTTGGAAACATGCAAAATCACAGTGAATGAATGGTAA TTCCCATTGAAATAGGATCCACACAAGGAAAAGCACTTGCCATTCGTTGGTTATTAGGGGCATCCCGAAAACGTCCCGGTCGAAATATGGCTTTCAAATTCAGTTCCGAATTAGTGGATGCTGCCAAAGGGAGTGGCGATGCCATACATTCTTTGGAAACATGCAAAATCACAGTGAATGAATGGTAA PIEIGSTQGKALAIRWLLGASRKRPGRNMAFKFSSELVDAAKGSGDAIHSLETCKITVNEW*
BLAST of Cucsa.318770 vs. Swiss-Prot
Match: RR7_CUCSA (30S ribosomal protein S7, chloroplastic OS=Cucumis sativus GN=rps7-A PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 3.3e-20 Identity = 49/52 (94.23%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Cucsa.318770 vs. Swiss-Prot
Match: RR7_DRIGR (30S ribosomal protein S7, chloroplastic OS=Drimys granadensis GN=rps7-A PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.7e-19 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. Swiss-Prot
Match: RR7_LEOCS (30S ribosomal protein S7, chloroplastic OS=Leopoldia comosa GN=rps7 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.7e-19 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. Swiss-Prot
Match: RR7_SPAWA (30S ribosomal protein S7, chloroplastic OS=Spathiphyllum wallisii GN=rps7 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.7e-19 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. Swiss-Prot
Match: RR7_ILLOL (30S ribosomal protein S7, chloroplastic OS=Illicium oligandrum GN=rps7-A PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.7e-19 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. TrEMBL
Match: A0A0K1L5V7_9LILI (Ribosomal protein S7 OS=Trillium tschonoskii GN=rps7 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 3.7e-18 Identity = 49/52 (94.23%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Cucsa.318770 vs. TrEMBL
Match: W8E233_9ROSI (Ribosomal protein S7 OS=Cucumis hystrix GN=rps7 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 3.7e-18 Identity = 49/52 (94.23%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Cucsa.318770 vs. TrEMBL
Match: A0A0A0L6M3_CUCSA (Ribosomal protein S7 OS=Cucumis sativus GN=Csa_3G128920 PE=3 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 3.7e-18 Identity = 49/52 (94.23%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Cucsa.318770 vs. TrEMBL
Match: A0A0U3E7Z1_9ROSI (30S ribosomal protein S7, chloroplastic OS=Aquilaria sinensis GN=rps7 PE=3 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 1.4e-17 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. TrEMBL
Match: Q6EM81_9MAGN (30S ribosomal protein S7, chloroplastic OS=Pachysandra terminalis GN=rps7 PE=3 SV=1) HSP 1 Score: 95.9 bits (237), Expect = 1.8e-17 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. TAIR10
Match: ATCG01240.1 (ATCG01240.1 ribosomal protein S7) HSP 1 Score: 95.9 bits (237), Expect = 9.3e-21 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. TAIR10
Match: ATCG00900.1 (ATCG00900.1 Ribosomal protein S7p/S5e family protein) HSP 1 Score: 95.9 bits (237), Expect = 9.3e-21 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. NCBI nr
Match: gi|918020914|ref|YP_009163322.1| (30S ribosomal protein S7 (plastid) [Trillium tschonoskii]) HSP 1 Score: 98.2 bits (243), Expect = 5.3e-18 Identity = 49/52 (94.23%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Cucsa.318770 vs. NCBI nr
Match: gi|68164849|ref|YP_247645.1| (ribosomal protein S7 [Cucumis sativus]) HSP 1 Score: 98.2 bits (243), Expect = 5.3e-18 Identity = 49/52 (94.23%), Postives = 49/52 (94.23%), Query Frame = 1
BLAST of Cucsa.318770 vs. NCBI nr
Match: gi|992331618|ref|YP_009229524.1| (ribosomal protein S7 (chloroplast) [Aquilaria sinensis]) HSP 1 Score: 96.3 bits (238), Expect = 2.0e-17 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. NCBI nr
Match: gi|643713747|gb|KDP26412.1| (hypothetical protein JCGZ_17570 [Jatropha curcas]) HSP 1 Score: 95.9 bits (237), Expect = 2.6e-17 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
BLAST of Cucsa.318770 vs. NCBI nr
Match: gi|34333512|gb|AAQ64548.1| (ribosomal protein S7 [Hernandia nymphaeifolia]) HSP 1 Score: 95.9 bits (237), Expect = 2.6e-17 Identity = 48/52 (92.31%), Postives = 48/52 (92.31%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|