Cucsa.260040 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAATTGGTATGTTATAATATGATATCAATTTAACCACGTTTTTGTTTCAAGGAAGATGGTGTATATAATTTGGAGGTTGGTTCAGGGAAGCAGCGGAGTAAGGCCTAATTAAGGGGATGGACATATAAAATGAAGAAGAAGGCTCAAGGGATCGGAGAACTGCCAGTGCCCACTGCAAATAATTTAATCAACTGCACCAAATTAGATATATATTAATGTCGTCGTGGAGGGAGTCGGATGTGTTGGACTCGATCCGTCAGCATCTTCTGGAAGAGAACTTAAACAAGAGTGGGGATGGGATTTGTAGTATTATTCAGGATCATCATTATAAAGGGGCGGCGGTGGAGAATGGAGTGCAGTTCAAGGGAGTGAGGCGGAGGCCATGGGGGAAATATGCGGCGGAGATAAGAGATCCAAAGAGAAATGGAGCCAGAACGTGGCTGGGGACCTTTGAAACGGCCCTAGAAGCAGCTTTGGCCTACGATCGAGCGGCTTTCAAAATCCGAGGAGCTAAGGCGAAACTCAACTTTCCACATCTCATTGATTCTGATTCTACACATTCTACTTCTGCTTCTACTTCGTCTGCTAACCCTCCTCCAAGTCCTACCCACGCCCACCATCAAACTTCTGCTGACAACTACGCCT atggaatTGGATCATCATTATAAAGGGGCGGCGGTGGAGAATGGAGTGCAGTTCAAGGGAGTGAGGCGGAGGCCATGGGGGAAATATGCGGCGGAGATAAGAGATCCAAAGAGAAATGGAGCCAGAACGTGGCTGGGGACCTTTGAAACGGCCCTAGAAGCAGCTTTGGCCTACGATCGAGCGGCTTTCAAAATCCGAGGAGCTAAGGCGAAACTCAACTTTCCACATCTCATTGATTCTGATTCTACACATTCTACTTCTGCTTCTACTTCGTCTGCTAACCCTCCTCCAAGTCCTACCCACGCCCACCATCAAACTTCTGCTGACAACTACGCCT ATGGAATTGGATCATCATTATAAAGGGGCGGCGGTGGAGAATGGAGTGCAGTTCAAGGGAGTGAGGCGGAGGCCATGGGGGAAATATGCGGCGGAGATAAGAGATCCAAAGAGAAATGGAGCCAGAACGTGGCTGGGGACCTTTGAAACGGCCCTAGAAGCAGCTTTGGCCTACGATCGAGCGGCTTTCAAAATCCGAGGAGCTAAGGCGAAACTCAACTTTCCACATCTCATTGATTCTGATTCTACACATTCTACTTCTGCTTCTACTTCGTCTGCTAACCCTCCTCCAAGTCCTACCCACGCCCACCATCAAACTTCTGCTGACAACTACGCCT MELDHHYKGAAVENGVQFKGVRRRPWGKYAAEIRDPKRNGARTWLGTFETALEAALAYDRAAFKIRGAKAKLNFPHLIDSDSTHSTSASTSSANPPPSPTHAHHQTSADNYAX
BLAST of Cucsa.260040 vs. Swiss-Prot
Match: ERF99_ARATH (Ethylene-responsive transcription factor 13 OS=Arabidopsis thaliana GN=ERF13 PE=2 SV=2) HSP 1 Score: 119.0 bits (297), Expect = 3.3e-26 Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = 1
BLAST of Cucsa.260040 vs. Swiss-Prot
Match: ERF2_NICSY (Ethylene-responsive transcription factor 2 OS=Nicotiana sylvestris GN=ERF2 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.2e-23 Identity = 50/89 (56.18%), Postives = 65/89 (73.03%), Query Frame = 1
BLAST of Cucsa.260040 vs. Swiss-Prot
Match: ERF2_TOBAC (Ethylene-responsive transcription factor 2 OS=Nicotiana tabacum GN=ERF2 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 1.2e-23 Identity = 50/89 (56.18%), Postives = 65/89 (73.03%), Query Frame = 1
BLAST of Cucsa.260040 vs. Swiss-Prot
Match: ERF1_TOBAC (Ethylene-responsive transcription factor 1 OS=Nicotiana tabacum GN=ERF1 PE=2 SV=1) HSP 1 Score: 106.3 bits (264), Expect = 2.2e-22 Identity = 50/98 (51.02%), Postives = 66/98 (67.35%), Query Frame = 1
BLAST of Cucsa.260040 vs. Swiss-Prot
Match: PTI5_SOLLC (Pathogenesis-related genes transcriptional activator PTI5 OS=Solanum lycopersicum GN=PTI5 PE=2 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.9e-22 Identity = 53/78 (67.95%), Postives = 60/78 (76.92%), Query Frame = 1
BLAST of Cucsa.260040 vs. TrEMBL
Match: A0A0A0L2V9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G116720 PE=4 SV=1) HSP 1 Score: 229.6 bits (584), Expect = 1.9e-57 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 1
BLAST of Cucsa.260040 vs. TrEMBL
Match: B9MV98_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0014s04600g PE=4 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.1e-27 Identity = 60/88 (68.18%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Cucsa.260040 vs. TrEMBL
Match: B9MV94_POPTR (Uncharacterized protein OS=Populus trichocarpa GN=POPTR_0014s04640g PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.4e-26 Identity = 59/91 (64.84%), Postives = 70/91 (76.92%), Query Frame = 1
BLAST of Cucsa.260040 vs. TrEMBL
Match: A0A072TWG2_MEDTR (Ethylene response factor OS=Medicago truncatula GN=MTR_8g006840 PE=4 SV=1) HSP 1 Score: 125.9 bits (315), Expect = 3.0e-26 Identity = 59/68 (86.76%), Postives = 63/68 (92.65%), Query Frame = 1
BLAST of Cucsa.260040 vs. TrEMBL
Match: A0A0D2RDC4_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_008G108500 PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 4.0e-26 Identity = 58/84 (69.05%), Postives = 69/84 (82.14%), Query Frame = 1
BLAST of Cucsa.260040 vs. TAIR10
Match: AT2G44840.1 (AT2G44840.1 ethylene-responsive element binding factor 13) HSP 1 Score: 119.0 bits (297), Expect = 1.9e-27 Identity = 54/86 (62.79%), Postives = 67/86 (77.91%), Query Frame = 1
BLAST of Cucsa.260040 vs. TAIR10
Match: AT4G17500.1 (AT4G17500.1 ethylene responsive element binding factor 1) HSP 1 Score: 105.1 bits (261), Expect = 2.8e-23 Identity = 52/90 (57.78%), Postives = 67/90 (74.44%), Query Frame = 1
BLAST of Cucsa.260040 vs. TAIR10
Match: AT5G13330.1 (AT5G13330.1 related to AP2 6l) HSP 1 Score: 105.1 bits (261), Expect = 2.8e-23 Identity = 53/88 (60.23%), Postives = 63/88 (71.59%), Query Frame = 1
BLAST of Cucsa.260040 vs. TAIR10
Match: AT3G23230.1 (AT3G23230.1 Integrase-type DNA-binding superfamily protein) HSP 1 Score: 102.8 bits (255), Expect = 1.4e-22 Identity = 53/82 (64.63%), Postives = 62/82 (75.61%), Query Frame = 1
BLAST of Cucsa.260040 vs. TAIR10
Match: AT5G47220.1 (AT5G47220.1 ethylene responsive element binding factor 2) HSP 1 Score: 102.4 bits (254), Expect = 1.8e-22 Identity = 51/89 (57.30%), Postives = 68/89 (76.40%), Query Frame = 1
BLAST of Cucsa.260040 vs. NCBI nr
Match: gi|449432980|ref|XP_004134276.1| (PREDICTED: ethylene-responsive transcription factor 13-like [Cucumis sativus]) HSP 1 Score: 229.6 bits (584), Expect = 2.8e-57 Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 1
BLAST of Cucsa.260040 vs. NCBI nr
Match: gi|659077723|ref|XP_008439349.1| (PREDICTED: ethylene-responsive transcription factor 13-like [Cucumis melo]) HSP 1 Score: 179.9 bits (455), Expect = 2.5e-42 Identity = 89/101 (88.12%), Postives = 91/101 (90.10%), Query Frame = 1
BLAST of Cucsa.260040 vs. NCBI nr
Match: gi|566202511|ref|XP_006375126.1| (hypothetical protein POPTR_0014s04600g [Populus trichocarpa]) HSP 1 Score: 129.8 bits (325), Expect = 3.0e-27 Identity = 60/88 (68.18%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Cucsa.260040 vs. NCBI nr
Match: gi|743943179|ref|XP_011016088.1| (PREDICTED: ethylene-responsive transcription factor 13-like [Populus euphratica]) HSP 1 Score: 129.8 bits (325), Expect = 3.0e-27 Identity = 60/88 (68.18%), Postives = 71/88 (80.68%), Query Frame = 1
BLAST of Cucsa.260040 vs. NCBI nr
Match: gi|743791786|ref|XP_011042382.1| (PREDICTED: ethylene-responsive transcription factor 13-like [Populus euphratica]) HSP 1 Score: 129.8 bits (325), Expect = 3.0e-27 Identity = 60/88 (68.18%), Postives = 71/88 (80.68%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|