Cucsa.255020 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAAACTCATGCAAAGGTATATAATTATCTTTTAAAAAAGTTTAGCTTCTTTCTCTTTATCTTAATGGTTAGTTTTTGTTTGTTTGATGTGTGACACACAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGGAGAAATTGCAGTCAAAATTATAGAGAAGGAAAACAGTTCGGTTAAAGCCATTATTGTTGAAGAAGGATCTTCTGTTGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCATCCACAAGAAGTCCAATATGGTTACTAAGACCCCGCACATTGGCTAA ATGCCAAACTCATGCAAAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGGAGAAATTGCAGTCAAAATTATAGAGAAGGAAAACAGTTCGGTTAAAGCCATTATTGTTGAAGAAGGATCTTCTGTTGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCATCCACAAGAAGTCCAATATGGTTACTAAGACCCCGCACATTGGCTAA ATGCCAAACTCATGCAAAGGAAAGAGCTCATGGCCAGAGCTTGTTAATGCTCCAGGAGAAATTGCAGTCAAAATTATAGAGAAGGAAAACAGTTCGGTTAAAGCCATTATTGTTGAAGAAGGATCTTCTGTTGTCACCAACTTCGAGTGTGGTCGAGTTTTTGTTTTCATCCACAAGAAGTCCAATATGGTTACTAAGACCCCGCACATTGGCTAA MPNSCKGKSSWPELVNAPGEIAVKIIEKENSSVKAIIVEEGSSVVTNFECGRVFVFIHKKSNMVTKTPHIG*
BLAST of Cucsa.255020 vs. Swiss-Prot
Match: ITH5_CUCMA (Inhibitor of trypsin and hageman factor OS=Cucurbita maxima PE=1 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.3e-12 Identity = 33/69 (47.83%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of Cucsa.255020 vs. Swiss-Prot
Match: ICI_LINUS (Proteinase inhibitor OS=Linum usitatissimum PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-10 Identity = 29/66 (43.94%), Postives = 45/66 (68.18%), Query Frame = 1
BLAST of Cucsa.255020 vs. Swiss-Prot
Match: HPI_HEVBR (Protease inhibitor HPI OS=Hevea brasiliensis GN=PI1 PE=1 SV=2) HSP 1 Score: 63.5 bits (153), Expect = 1.1e-09 Identity = 32/71 (45.07%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of Cucsa.255020 vs. Swiss-Prot
Match: BGIA_MOMCH (Glu S.griseus protease inhibitor OS=Momordica charantia PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.4e-09 Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = 1
BLAST of Cucsa.255020 vs. Swiss-Prot
Match: ATSI_AMACA (Trypsin/subtilisin inhibitor OS=Amaranthus caudatus PE=1 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.7e-07 Identity = 27/66 (40.91%), Postives = 39/66 (59.09%), Query Frame = 1
BLAST of Cucsa.255020 vs. TrEMBL
Match: A0A0A0L593_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142950 PE=4 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.4e-32 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Cucsa.255020 vs. TrEMBL
Match: A0A0A0L795_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142960 PE=4 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.4e-15 Identity = 42/71 (59.15%), Postives = 54/71 (76.06%), Query Frame = 1
BLAST of Cucsa.255020 vs. TrEMBL
Match: A0A0A0L4J0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G142970 PE=4 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 6.4e-14 Identity = 42/71 (59.15%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of Cucsa.255020 vs. TrEMBL
Match: A0A022R205_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a021802mg PE=4 SV=1) HSP 1 Score: 79.3 bits (194), Expect = 2.1e-12 Identity = 38/71 (53.52%), Postives = 47/71 (66.20%), Query Frame = 1
BLAST of Cucsa.255020 vs. TrEMBL
Match: A0A0B2Q012_GLYSO (Proteinase inhibitor OS=Glycine soja GN=glysoja_040427 PE=4 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 3.5e-12 Identity = 38/71 (53.52%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of Cucsa.255020 vs. TAIR10
Match: AT2G38870.1 (AT2G38870.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 62.0 bits (149), Expect = 1.7e-10 Identity = 30/71 (42.25%), Postives = 42/71 (59.15%), Query Frame = 1
BLAST of Cucsa.255020 vs. TAIR10
Match: AT5G43580.1 (AT5G43580.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 60.5 bits (145), Expect = 5.0e-10 Identity = 30/65 (46.15%), Postives = 45/65 (69.23%), Query Frame = 1
BLAST of Cucsa.255020 vs. TAIR10
Match: AT3G46860.1 (AT3G46860.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.8 bits (125), Expect = 1.0e-07 Identity = 27/64 (42.19%), Postives = 37/64 (57.81%), Query Frame = 1
BLAST of Cucsa.255020 vs. TAIR10
Match: AT2G38900.2 (AT2G38900.2 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 52.0 bits (123), Expect = 1.8e-07 Identity = 24/65 (36.92%), Postives = 40/65 (61.54%), Query Frame = 1
BLAST of Cucsa.255020 vs. TAIR10
Match: AT5G43570.1 (AT5G43570.1 Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 51.6 bits (122), Expect = 2.3e-07 Identity = 27/61 (44.26%), Postives = 40/61 (65.57%), Query Frame = 1
BLAST of Cucsa.255020 vs. NCBI nr
Match: gi|700201770|gb|KGN56903.1| (hypothetical protein Csa_3G142950 [Cucumis sativus]) HSP 1 Score: 146.4 bits (368), Expect = 2.0e-32 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 1
BLAST of Cucsa.255020 vs. NCBI nr
Match: gi|659076231|ref|XP_008438569.1| (PREDICTED: inhibitor of trypsin and hageman factor-like [Cucumis melo]) HSP 1 Score: 135.2 bits (339), Expect = 4.6e-29 Identity = 64/71 (90.14%), Postives = 68/71 (95.77%), Query Frame = 1
BLAST of Cucsa.255020 vs. NCBI nr
Match: gi|449432606|ref|XP_004134090.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis sativus]) HSP 1 Score: 88.6 bits (218), Expect = 4.9e-15 Identity = 42/71 (59.15%), Postives = 54/71 (76.06%), Query Frame = 1
BLAST of Cucsa.255020 vs. NCBI nr
Match: gi|700201772|gb|KGN56905.1| (hypothetical protein Csa_3G142970 [Cucumis sativus]) HSP 1 Score: 84.3 bits (207), Expect = 9.2e-14 Identity = 42/71 (59.15%), Postives = 50/71 (70.42%), Query Frame = 1
BLAST of Cucsa.255020 vs. NCBI nr
Match: gi|659076233|ref|XP_008438570.1| (PREDICTED: glu S.griseus protease inhibitor-like [Cucumis melo]) HSP 1 Score: 83.2 bits (204), Expect = 2.1e-13 Identity = 40/71 (56.34%), Postives = 52/71 (73.24%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |