Cucsa.252330 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCAGACGAAGATTTGATTGAGCTTAAGTTCCGACTTTATGATGGATTAGATATTGGTCCATTTTGTTATTCCCCAACTTCAACTATAGTCATGGTTAAGGAGAGGGTTGTTGCATAA ATGCCAGACGAAGATTTGATTGAGCTTAAGTTCCGACTTTATGATGGATTAGATATTGGTCCATTTTGTTATTCCCCAACTTCAACTATAGTCATGGTTAAGGAGAGGGTTGTTGCATAA ATGCCAGACGAAGATTTGATTGAGCTTAAGTTCCGACTTTATGATGGATTAGATATTGGTCCATTTTGTTATTCCCCAACTTCAACTATAGTCATGGTTAAGGAGAGGGTTGTTGCATAA MPDEDLIELKFRLYDGLDIGPFCYSPTSTIVMVKERVVA*
BLAST of Cucsa.252330 vs. Swiss-Prot
Match: MUB4_ARATH (Membrane-anchored ubiquitin-fold protein 4 OS=Arabidopsis thaliana GN=MUB4 PE=1 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 5.3e-11 Identity = 28/39 (71.79%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. Swiss-Prot
Match: MUB3_ARATH (Membrane-anchored ubiquitin-fold protein 3 OS=Arabidopsis thaliana GN=MUB3 PE=1 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 2.1e-07 Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 1
BLAST of Cucsa.252330 vs. Swiss-Prot
Match: MUB5_ARATH (Membrane-anchored ubiquitin-fold protein 5 OS=Arabidopsis thaliana GN=MUB5 PE=1 SV=1) HSP 1 Score: 51.2 bits (121), Expect = 3.0e-06 Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 1
BLAST of Cucsa.252330 vs. TrEMBL
Match: A0A0A0L887_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G563280 PE=4 SV=1) HSP 1 Score: 73.9 bits (180), Expect = 4.8e-11 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. TrEMBL
Match: A0A059APN7_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_I01624 PE=4 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 5.3e-10 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. TrEMBL
Match: M1BSQ1_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400020203 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 9.1e-10 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. TrEMBL
Match: M1BSQ2_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400020203 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 9.1e-10 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. TrEMBL
Match: A0A0V0HJW8_SOLCH (Putative membrane-anchored ubiquitin-fold protein 4-like OS=Solanum chacoense PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 9.1e-10 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. TAIR10
Match: AT3G26980.1 (AT3G26980.1 membrane-anchored ubiquitin-fold protein 4 precursor) HSP 1 Score: 67.0 bits (162), Expect = 3.0e-12 Identity = 28/39 (71.79%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. TAIR10
Match: AT4G24990.1 (AT4G24990.1 Ubiquitin family protein) HSP 1 Score: 55.1 bits (131), Expect = 1.2e-08 Identity = 24/39 (61.54%), Postives = 32/39 (82.05%), Query Frame = 1
BLAST of Cucsa.252330 vs. TAIR10
Match: AT1G77870.1 (AT1G77870.1 membrane-anchored ubiquitin-fold protein 5 precursor) HSP 1 Score: 51.2 bits (121), Expect = 1.7e-07 Identity = 24/39 (61.54%), Postives = 29/39 (74.36%), Query Frame = 1
BLAST of Cucsa.252330 vs. NCBI nr
Match: gi|778681599|ref|XP_011651547.1| (PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Cucumis sativus]) HSP 1 Score: 73.9 bits (180), Expect = 6.9e-11 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. NCBI nr
Match: gi|659098435|ref|XP_008450137.1| (PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Cucumis melo]) HSP 1 Score: 73.9 bits (180), Expect = 6.9e-11 Identity = 35/39 (89.74%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. NCBI nr
Match: gi|702464692|ref|XP_010028973.1| (PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Eucalyptus grandis]) HSP 1 Score: 70.5 bits (171), Expect = 7.7e-10 Identity = 31/39 (79.49%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. NCBI nr
Match: gi|565343185|ref|XP_006338719.1| (PREDICTED: membrane-anchored ubiquitin-fold protein 4 [Solanum tuberosum]) HSP 1 Score: 69.7 bits (169), Expect = 1.3e-09 Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 1
BLAST of Cucsa.252330 vs. NCBI nr
Match: gi|698517744|ref|XP_009803755.1| (PREDICTED: membrane-anchored ubiquitin-fold protein 4 isoform X1 [Nicotiana sylvestris]) HSP 1 Score: 69.3 bits (168), Expect = 1.7e-09 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |