Cucsa.207470 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GCTAACGCAATCATGTTTTGATAACTGTGTTGACAAGAGGTTGGACAGTTGTCTAATCTTGAATATTGCATGCTTTCTAACCATAGAATTCAATTTCTCATGGCTATTGTTTTTAGCATTATAAGATTGATTCTATCTTATTATTCATTTTGAGATTTATGCATGGTCTTTTGTCATTCAACAACTACCATCTATTTTATTTTAGGTACAAGGAATCTGAGCTGAATATGTGTAAAAATAGTTGTATTGACCACTGTGTTTCCAAGTATTGGCATGTAAGCTGA GCTAACGCAATCATGTTTTGATAACTGTGTTGACAAGAGGTACAAGGAATCTGAGCTGAATATGTGTAAAAATAGTTGTATTGACCACTGTGTTTCCAAGTATTGGCATGTAAGCTGA GCTAACGCAATCATGTTTTGATAACTGTGTTGACAAGAGGTACAAGGAATCTGAGCTGAATATGTGTAAAAATAGTTGTATTGACCACTGTGTTTCCAAGTATTGGCATGTAAGCTGA LTQSCFDNCVDKRYKESELNMCKNSCIDHCVSKYWHVS*
BLAST of Cucsa.207470 vs. Swiss-Prot
Match: TIM10_ARATH (Mitochondrial import inner membrane translocase subunit TIM10 OS=Arabidopsis thaliana GN=TIM10 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 2.3e-11 Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 1
BLAST of Cucsa.207470 vs. TrEMBL
Match: A0A0A0LVG1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G527890 PE=3 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 1.6e-11 Identity = 32/38 (84.21%), Postives = 35/38 (92.11%), Query Frame = 1
BLAST of Cucsa.207470 vs. TrEMBL
Match: A0A0R0GDI8_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_15G229800 PE=3 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 8.0e-11 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = 1
BLAST of Cucsa.207470 vs. TrEMBL
Match: A0A0B2RLH8_GLYSO (Mitochondrial import inner membrane translocase subunit Tim10 (Fragment) OS=Glycine soja GN=glysoja_038777 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.0e-10 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.207470 vs. TrEMBL
Match: K7MDA8_SOYBN (Uncharacterized protein OS=Glycine max PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.0e-10 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.207470 vs. TrEMBL
Match: C6T199_SOYBN (Uncharacterized protein OS=Glycine max PE=2 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 2.3e-10 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = 1
BLAST of Cucsa.207470 vs. TAIR10
Match: AT2G29530.3 (AT2G29530.3 Tim10/DDP family zinc finger protein) HSP 1 Score: 68.2 bits (165), Expect = 1.3e-12 Identity = 28/38 (73.68%), Postives = 33/38 (86.84%), Query Frame = 1
BLAST of Cucsa.207470 vs. NCBI nr
Match: gi|449455056|ref|XP_004145269.1| (PREDICTED: mitochondrial import inner membrane translocase subunit TIM10 [Cucumis sativus]) HSP 1 Score: 75.5 bits (184), Expect = 2.3e-11 Identity = 32/38 (84.21%), Postives = 35/38 (92.11%), Query Frame = 1
BLAST of Cucsa.207470 vs. NCBI nr
Match: gi|571520947|ref|XP_006598086.1| (PREDICTED: mitochondrial import inner membrane translocase subunit TIM10-like [Glycine max]) HSP 1 Score: 73.2 bits (178), Expect = 1.2e-10 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = 1
BLAST of Cucsa.207470 vs. NCBI nr
Match: gi|734404112|gb|KHN32848.1| (Mitochondrial import inner membrane translocase subunit Tim10, partial [Glycine soja]) HSP 1 Score: 72.8 bits (177), Expect = 1.5e-10 Identity = 29/37 (78.38%), Postives = 33/37 (89.19%), Query Frame = 1
BLAST of Cucsa.207470 vs. NCBI nr
Match: gi|356501739|ref|XP_003519681.1| (PREDICTED: mitochondrial import inner membrane translocase subunit TIM10 [Glycine max]) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-10 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = 1
BLAST of Cucsa.207470 vs. NCBI nr
Match: gi|356557736|ref|XP_003547167.1| (PREDICTED: mitochondrial import inner membrane translocase subunit TIM10-like [Glycine max]) HSP 1 Score: 71.6 bits (174), Expect = 3.4e-10 Identity = 29/38 (76.32%), Postives = 34/38 (89.47%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|