Cucsa.194290 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.TCTCTATGCATTCAACCATGAGAATAAGCCCATTTATTTGACGACATTTTTGTCATTCATCTATGCTTTAGGGCATTTCTTAACTGAATACTTGATATATCATACCATGTCCCATTGCAAATATGATGAGTGA TCTCTATGCATTCAACCATGAGAATAAGCCCATTTATTTGACGACATTTTTGTCATTCATCTATGCTTTAGGGCATTTCTTAACTGAATACTTGATATATCATACCATGTCCCATTGCAAATATGATGAGTGA TCTCTATGCATTCAACCATGAGAATAAGCCCATTTATTTGACGACATTTTTGTCATTCATCTATGCTTTAGGGCATTTCTTAACTGAATACTTGATATATCATACCATGTCCCATTGCAAATATGATGAGTGA LYAFNHENKPIYLTTFLSFIYALGHFLTEYLIYHTMSHCKYDE*
BLAST of Cucsa.194290 vs. Swiss-Prot
Match: ERG28_ARATH (Ergosterol biosynthetic protein 28 OS=Arabidopsis thaliana GN=At1g10030 PE=2 SV=2) HSP 1 Score: 65.5 bits (158), Expect = 1.7e-10 Identity = 30/37 (81.08%), Postives = 32/37 (86.49%), Query Frame = 1
BLAST of Cucsa.194290 vs. TrEMBL
Match: A0A0A0LGZ9_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G894520 PE=4 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.0e-10 Identity = 34/37 (91.89%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. TrEMBL
Match: A0A0D3HX27_9ORYZ (Uncharacterized protein OS=Oryza barthii PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 7.7e-10 Identity = 32/37 (86.49%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. TrEMBL
Match: M5VQ76_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa013304mg PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.0e-09 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. TrEMBL
Match: W5AP36_WHEAT (Uncharacterized protein OS=Triticum aestivum PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.3e-09 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. TrEMBL
Match: F2CPZ8_HORVD (Predicted protein OS=Hordeum vulgare var. distichum PE=2 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 1.3e-09 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. TAIR10
Match: AT1G10030.1 (AT1G10030.1 homolog of yeast ergosterol28) HSP 1 Score: 65.5 bits (158), Expect = 9.6e-12 Identity = 30/37 (81.08%), Postives = 32/37 (86.49%), Query Frame = 1
BLAST of Cucsa.194290 vs. NCBI nr
Match: gi|449436908|ref|XP_004136234.1| (PREDICTED: ergosterol biosynthetic protein 28 [Cucumis sativus]) HSP 1 Score: 72.0 bits (175), Expect = 2.9e-10 Identity = 34/37 (91.89%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. NCBI nr
Match: gi|659132238|ref|XP_008466094.1| (PREDICTED: ergosterol biosynthetic protein 28 [Cucumis melo]) HSP 1 Score: 72.0 bits (175), Expect = 2.9e-10 Identity = 34/37 (91.89%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. NCBI nr
Match: gi|595801980|ref|XP_007201912.1| (hypothetical protein PRUPE_ppa013304mg [Prunus persica]) HSP 1 Score: 69.7 bits (169), Expect = 1.4e-09 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. NCBI nr
Match: gi|326490511|dbj|BAJ84919.1| (predicted protein [Hordeum vulgare subsp. vulgare]) HSP 1 Score: 69.3 bits (168), Expect = 1.9e-09 Identity = 31/37 (83.78%), Postives = 34/37 (91.89%), Query Frame = 1
BLAST of Cucsa.194290 vs. NCBI nr
Match: gi|645261309|ref|XP_008236232.1| (PREDICTED: ergosterol biosynthetic protein 28 [Prunus mume]) HSP 1 Score: 68.9 bits (167), Expect = 2.5e-09 Identity = 30/35 (85.71%), Postives = 33/35 (94.29%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|