Cucsa.178760 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCATGTCAAAAAGAATCACACTTGTTTTTATTGAGATTTTCTTGATTAGCTTTAACATCCTTACGATGACAGATGCTAGAAAATTCATTGATTACCATTCTATAGTTGCAGGAGATGTTAGCCCCGGATGTAACCCAAAGCATCCTGAACTTTGTAAATTAACTCCAGCAAATCCATATGAAAGAGGTTGCAATAAAATCAATCGCTGTAGAGGAGGAAATATATATAATTGA ATGATCATGTCAAAAAGAATCACACTTGTTTTTATTGAGATTTTCTTGATTAGCTTTAACATCCTTACGATGACAGATGCTAGAAAATTCATTGATTACCATTCTATAGTTGCAGGAGATGTTAGCCCCGGATGTAACCCAAAGCATCCTGAACTTTGTAAATTAACTCCAGCAAATCCATATGAAAGAGGTTGCAATAAAATCAATCGCTGTAGAGGAGGAAATATATATAATTGA ATGATCATGTCAAAAAGAATCACACTTGTTTTTATTGAGATTTTCTTGATTAGCTTTAACATCCTTACGATGACAGATGCTAGAAAATTCATTGATTACCATTCTATAGTTGCAGGAGATGTTAGCCCCGGATGTAACCCAAAGCATCCTGAACTTTGTAAATTAACTCCAGCAAATCCATATGAAAGAGGTTGCAATAAAATCAATCGCTGTAGAGGAGGAAATATATATAATTGA MIMSKRITLVFIEIFLISFNILTMTDARKFIDYHSIVAGDVSPGCNPKHPELCKLTPANPYERGCNKINRCRGGNIYN*
BLAST of Cucsa.178760 vs. Swiss-Prot
Match: RLF9_ARATH (Protein RALF-like 9 OS=Arabidopsis thaliana GN=RALFL9 PE=3 SV=1) HSP 1 Score: 67.0 bits (162), Expect = 1.0e-10 Identity = 35/76 (46.05%), Postives = 47/76 (61.84%), Query Frame = 1
BLAST of Cucsa.178760 vs. Swiss-Prot
Match: RLF15_ARATH (Protein RALF-like 15 OS=Arabidopsis thaliana GN=RALFL15 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 1.8e-07 Identity = 31/74 (41.89%), Postives = 41/74 (55.41%), Query Frame = 1
BLAST of Cucsa.178760 vs. Swiss-Prot
Match: RLF20_ARATH (Protein RALF-like 20 OS=Arabidopsis thaliana GN=RALFL20 PE=3 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 7.8e-06 Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 1
BLAST of Cucsa.178760 vs. TrEMBL
Match: A0A0A0L8B1_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G426350 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 5.2e-25 Identity = 54/75 (72.00%), Postives = 67/75 (89.33%), Query Frame = 1
BLAST of Cucsa.178760 vs. TrEMBL
Match: V4UF46_9ROSI (Uncharacterized protein OS=Citrus clementina GN=CICLE_v10018043mg PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-08 Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Cucsa.178760 vs. TrEMBL
Match: A0A067F0E4_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g041712mg PE=4 SV=1) HSP 1 Score: 65.5 bits (158), Expect = 3.4e-08 Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Cucsa.178760 vs. TrEMBL
Match: D7KVJ4_ARALL (Putative uncharacterized protein OS=Arabidopsis lyrata subsp. lyrata GN=ARALYDRAFT_893358 PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-06 Identity = 32/77 (41.56%), Postives = 45/77 (58.44%), Query Frame = 1
BLAST of Cucsa.178760 vs. TrEMBL
Match: A0A078IYN5_BRANA (BnaCnng31830D protein OS=Brassica napus GN=BnaCnng31830D PE=4 SV=1) HSP 1 Score: 60.1 bits (144), Expect = 1.4e-06 Identity = 32/77 (41.56%), Postives = 47/77 (61.04%), Query Frame = 1
BLAST of Cucsa.178760 vs. TAIR10
Match: AT1G61566.1 (AT1G61566.1 ralf-like 9) HSP 1 Score: 67.0 bits (162), Expect = 5.9e-12 Identity = 35/76 (46.05%), Postives = 47/76 (61.84%), Query Frame = 1
BLAST of Cucsa.178760 vs. TAIR10
Match: AT2G22055.1 (AT2G22055.1 RALF-like 15) HSP 1 Score: 56.2 bits (134), Expect = 1.0e-08 Identity = 31/74 (41.89%), Postives = 41/74 (55.41%), Query Frame = 1
BLAST of Cucsa.178760 vs. TAIR10
Match: AT2G34825.1 (AT2G34825.1 RALF-like 20) HSP 1 Score: 50.8 bits (120), Expect = 4.4e-07 Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 1
BLAST of Cucsa.178760 vs. TAIR10
Match: AT1G23145.1 (AT1G23145.1 RALF-like 2) HSP 1 Score: 48.5 bits (114), Expect = 2.2e-06 Identity = 28/69 (40.58%), Postives = 36/69 (52.17%), Query Frame = 1
BLAST of Cucsa.178760 vs. TAIR10
Match: AT1G35467.1 (AT1G35467.1 RALF-like 5) HSP 1 Score: 47.0 bits (110), Expect = 6.3e-06 Identity = 25/72 (34.72%), Postives = 37/72 (51.39%), Query Frame = 1
BLAST of Cucsa.178760 vs. NCBI nr
Match: gi|700202865|gb|KGN57998.1| (hypothetical protein Csa_3G426350 [Cucumis sativus]) HSP 1 Score: 121.3 bits (303), Expect = 7.5e-25 Identity = 54/75 (72.00%), Postives = 67/75 (89.33%), Query Frame = 1
BLAST of Cucsa.178760 vs. NCBI nr
Match: gi|21592626|gb|AAM64575.1| (unknown [Arabidopsis thaliana]) HSP 1 Score: 67.0 bits (162), Expect = 1.7e-08 Identity = 35/76 (46.05%), Postives = 47/76 (61.84%), Query Frame = 1
BLAST of Cucsa.178760 vs. NCBI nr
Match: gi|18407238|ref|NP_564779.1| (protein RALF-like 9 [Arabidopsis thaliana]) HSP 1 Score: 67.0 bits (162), Expect = 1.7e-08 Identity = 35/76 (46.05%), Postives = 47/76 (61.84%), Query Frame = 1
BLAST of Cucsa.178760 vs. NCBI nr
Match: gi|567910725|ref|XP_006447676.1| (hypothetical protein CICLE_v10018043mg [Citrus clementina]) HSP 1 Score: 65.5 bits (158), Expect = 4.9e-08 Identity = 33/75 (44.00%), Postives = 47/75 (62.67%), Query Frame = 1
BLAST of Cucsa.178760 vs. NCBI nr
Match: gi|1009128592|ref|XP_015881314.1| (PREDICTED: protein RALF-like 9 [Ziziphus jujuba]) HSP 1 Score: 60.8 bits (146), Expect = 1.2e-06 Identity = 30/73 (41.10%), Postives = 43/73 (58.90%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|