Cucsa.141910 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATTGTCAACATGAGCTTAGCTCAACTGGCACCTGTATGTTCATAAACATTTATTGTGTTCTTAAATCCTCTCGTGTCTATAAAAATACAAGATTCCATTTTGAAATCAGAACCCACCAACGCCTCATTGATATTTTGTACCCTACTGTCCAAACAATCGATTTTTTGATGCAACTCGACCTTCGAAGAAATTGA attgtcaacatgagcttagctcaactggcacctgtatgttcATAAACATTTATTGTGTTCTTAAATCCTCTCGTGTCTATAAAAATACAAGATTCCATTTTGAAATCAGAACCCACCAACGCCTCATTGATATTTTGTACCCTACTGTCCAAACAATCGATTTTTTGATGCAACTCGACCTTCGAAGAAATTGA ATTGTCAACATGAGCTTAGCTCAACTGGCACCTGTATGTTCATAAACATTTATTGTGTTCTTAAATCCTCTCGTGTCTATAAAAATACAAGATTCCATTTTGAAATCAGAACCCACCAACGCCTCATTGATATTTTGTACCCTACTGTCCAAACAATCGATTTTTTGATGCAACTCGACCTTCGAAGAAATTGA CQHELSSTGTCMFINIYCVLKSSRVYKNTRFHFEIRTHQRLIDILYPTVQTIDFLMQLDLRRN*
BLAST of Cucsa.141910 vs. Swiss-Prot
Match: RR10_ARATH (30S ribosomal protein S10, chloroplastic OS=Arabidopsis thaliana GN=RPS10 PE=2 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 1.3e-14 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. Swiss-Prot
Match: RR10_MESCR (30S ribosomal protein S10, chloroplastic OS=Mesembryanthemum crystallinum GN=RPS10 PE=2 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.2e-14 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. Swiss-Prot
Match: RS10_STRCO (30S ribosomal protein S10 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsJ PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 6.5e-11 Identity = 30/46 (65.22%), Postives = 39/46 (84.78%), Query Frame = 1
BLAST of Cucsa.141910 vs. Swiss-Prot
Match: RS10_STRAW (30S ribosomal protein S10 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsJ PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 6.5e-11 Identity = 30/46 (65.22%), Postives = 39/46 (84.78%), Query Frame = 1
BLAST of Cucsa.141910 vs. Swiss-Prot
Match: RS10_STRGG (30S ribosomal protein S10 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpsJ PE=3 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 6.5e-11 Identity = 30/46 (65.22%), Postives = 39/46 (84.78%), Query Frame = 1
BLAST of Cucsa.141910 vs. TrEMBL
Match: A9YUX9_DAUCA (Chloroplast 30S ribosomal protein S10 (Fragment) OS=Daucus carota PE=2 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.3e-13 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. TrEMBL
Match: A0A067L5B3_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_01016 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.3e-13 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. TrEMBL
Match: A0A0K9RWE7_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_026730 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.3e-13 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. TrEMBL
Match: A0A0A0LEH6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G769090 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.3e-13 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. TrEMBL
Match: I1N0C3_SOYBN (Uncharacterized protein OS=Glycine max GN=GLYMA_18G079900 PE=3 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.3e-13 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. TAIR10
Match: AT3G13120.1 (AT3G13120.1 Ribosomal protein S10p/S20e family protein) HSP 1 Score: 79.7 bits (195), Expect = 7.1e-16 Identity = 37/45 (82.22%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. NCBI nr
Match: gi|947049013|gb|KRG98541.1| (hypothetical protein GLYMA_18G079900 [Glycine max]) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-12 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. NCBI nr
Match: gi|702379638|ref|XP_010063278.1| (PREDICTED: 30S ribosomal protein S10, chloroplastic [Eucalyptus grandis]) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-12 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. NCBI nr
Match: gi|470110576|ref|XP_004291556.1| (PREDICTED: 30S ribosomal protein S10, chloroplastic [Fragaria vesca subsp. vesca]) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-12 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. NCBI nr
Match: gi|162945917|gb|ABY20970.1| (chloroplast 30S ribosomal protein S10, partial [Daucus carota]) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-12 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
BLAST of Cucsa.141910 vs. NCBI nr
Match: gi|657987535|ref|XP_008385921.1| (PREDICTED: 30S ribosomal protein S10, chloroplastic [Malus domestica]) HSP 1 Score: 80.5 bits (197), Expect = 1.2e-12 Identity = 38/45 (84.44%), Postives = 40/45 (88.89%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |