Cucsa.126860 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTTCCACTCGCGAAGGTCACTACAGAGGCGTCCGAAAGCGTCCATGGGGTCGCTACGCCGCCGAAATACGCGACCCTTGGAAGAAAACCCGTGTTTGGTTAGGCACTTTCGATACTCCTGAAGAAGCCGCCCTTGCCTACGACGGCGCCGCCCGTTCCCTCCGCGGCTCCAAAGCTAAAACCAACTTCCCTCCTCCCCTCCCTGGTCTCTCCCTCGACCTCAACGTCTCCGGACCTTGGCCCACACCTACCTCTGCACCCCCTTGTTCATCCTCCTCCTCCTCCCCCTCCCCCTCCTCCACTCGTTTTCTCCTCGGCGATTTCCTCCGTCACGGCGTCAGAAACGATATATGTAATCTCAATGTGGATGCCTCTCCGGTTCTTGTGGACTCAAGCGCTTCGGGTTCTTCCACCGCTTCGGCGTCGTTTATTGGTCACGTCCGACGTGGCCTCCCTTTTGATCTCAACGAGCCTCCACCG ATGGCTTCCACTCGCGAAGGTCACTACAGAGGCGTCCGAAAGCGTCCATGGGGTCGCTACGCCGCCGAAATACGCGACCCTTGGAAGAAAACCCGTGTTTGGTTAGGCACTTTCGATACTCCTGAAGAAGCCGCCCTTGCCTACGACGGCGCCGCCCGTTCCCTCCGCGGCTCCAAAGCTAAAACCAACTTCCCTCCTCCCCTCCCTGGTCTCTCCCTCGACCTCAACGTCTCCGGACCTTGGCCCACACCTACCTCTGCACCCCCTTGTTCAtcctcctcctcctccccctccccctcctccACTCGTTTTCTCCTCGGCGATTTCCTCCGTCACGGCGTCAGAAACGATATATGTAATCTCAATGTGGATGCCTCTCCGGTTCTTGTGGACTCAAGCGCTTCGGGTTCTTCCACCGCTTCGGCGTCGTTTATTGGTCACGTCCGACGTGGCCTCCCTTTTGATCTCAACGAGCCTCCACCG ATGGCTTCCACTCGCGAAGGTCACTACAGAGGCGTCCGAAAGCGTCCATGGGGTCGCTACGCCGCCGAAATACGCGACCCTTGGAAGAAAACCCGTGTTTGGTTAGGCACTTTCGATACTCCTGAAGAAGCCGCCCTTGCCTACGACGGCGCCGCCCGTTCCCTCCGCGGCTCCAAAGCTAAAACCAACTTCCCTCCTCCCCTCCCTGGTCTCTCCCTCGACCTCAACGTCTCCGGACCTTGGCCCACACCTACCTCTGCACCCCCTTGTTCATCCTCCTCCTCCTCCCCCTCCCCCTCCTCCACTCGTTTTCTCCTCGGCGATTTCCTCCGTCACGGCGTCAGAAACGATATATGTAATCTCAATGTGGATGCCTCTCCGGTTCTTGTGGACTCAAGCGCTTCGGGTTCTTCCACCGCTTCGGCGTCGTTTATTGGTCACGTCCGACGTGGCCTCCCTTTTGATCTCAACGAGCCTCCACCG MASTREGHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGSKAKTNFPPPLPGLSLDLNVSGPWPTPTSAPPCSSSSSSPSPSSTRFLLGDFLRHGVRNDICNLNVDASPVLVDSSASGSSTASASFIGHVRRGLPFDLNEPPP
BLAST of Cucsa.126860 vs. Swiss-Prot
Match: ERF81_ARATH (Ethylene-responsive transcription factor 12 OS=Arabidopsis thaliana GN=ERF12 PE=2 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 2.3e-36 Identity = 100/193 (51.81%), Postives = 110/193 (56.99%), Query Frame = 1
BLAST of Cucsa.126860 vs. Swiss-Prot
Match: ERF3_TOBAC (Ethylene-responsive transcription factor 3 OS=Nicotiana tabacum GN=ERF3 PE=2 SV=1) HSP 1 Score: 118.6 bits (296), Expect = 6.2e-26 Identity = 80/191 (41.88%), Postives = 98/191 (51.31%), Query Frame = 1
BLAST of Cucsa.126860 vs. Swiss-Prot
Match: ERF80_ARATH (Ethylene-responsive transcription factor 9 OS=Arabidopsis thaliana GN=ERF9 PE=2 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 3.1e-25 Identity = 58/75 (77.33%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of Cucsa.126860 vs. Swiss-Prot
Match: ERF82_ARATH (Ethylene-responsive transcription factor 3 OS=Arabidopsis thaliana GN=ERF3 PE=1 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 4.4e-24 Identity = 54/74 (72.97%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of Cucsa.126860 vs. Swiss-Prot
Match: ERF4_TOBAC (Ethylene-responsive transcription factor 4 OS=Nicotiana tabacum GN=ERF4 PE=1 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 7.6e-24 Identity = 52/63 (82.54%), Postives = 54/63 (85.71%), Query Frame = 1
BLAST of Cucsa.126860 vs. TrEMBL
Match: A0A0A0LSE4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G075030 PE=4 SV=1) HSP 1 Score: 336.7 bits (862), Expect = 1.6e-89 Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 1
BLAST of Cucsa.126860 vs. TrEMBL
Match: A0A067JE07_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_21469 PE=4 SV=1) HSP 1 Score: 191.0 bits (484), Expect = 1.1e-45 Identity = 103/171 (60.23%), Postives = 115/171 (67.25%), Query Frame = 1
BLAST of Cucsa.126860 vs. TrEMBL
Match: B9RBB0_RICCO (Ethylene-responsive transcription factor, putative OS=Ricinus communis GN=RCOM_1673780 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 7.1e-45 Identity = 101/169 (59.76%), Postives = 115/169 (68.05%), Query Frame = 1
BLAST of Cucsa.126860 vs. TrEMBL
Match: A0A022QNG6_ERYGU (Uncharacterized protein OS=Erythranthe guttata GN=MIMGU_mgv1a015643mg PE=4 SV=1) HSP 1 Score: 186.8 bits (473), Expect = 2.1e-44 Identity = 99/163 (60.74%), Postives = 106/163 (65.03%), Query Frame = 1
BLAST of Cucsa.126860 vs. TrEMBL
Match: K4B909_SOLLC (Uncharacterized protein OS=Solanum lycopersicum PE=4 SV=1) HSP 1 Score: 186.8 bits (473), Expect = 2.1e-44 Identity = 104/167 (62.28%), Postives = 116/167 (69.46%), Query Frame = 1
BLAST of Cucsa.126860 vs. TAIR10
Match: AT1G28360.1 (AT1G28360.1 ERF domain protein 12) HSP 1 Score: 153.3 bits (386), Expect = 1.3e-37 Identity = 100/193 (51.81%), Postives = 110/193 (56.99%), Query Frame = 1
BLAST of Cucsa.126860 vs. TAIR10
Match: AT5G44210.1 (AT5G44210.1 erf domain protein 9) HSP 1 Score: 116.3 bits (290), Expect = 1.7e-26 Identity = 58/75 (77.33%), Postives = 61/75 (81.33%), Query Frame = 1
BLAST of Cucsa.126860 vs. TAIR10
Match: AT1G50640.1 (AT1G50640.1 ethylene responsive element binding factor 3) HSP 1 Score: 112.5 bits (280), Expect = 2.5e-25 Identity = 54/74 (72.97%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of Cucsa.126860 vs. TAIR10
Match: AT3G15210.1 (AT3G15210.1 ethylene responsive element binding factor 4) HSP 1 Score: 110.2 bits (274), Expect = 1.2e-24 Identity = 62/102 (60.78%), Postives = 71/102 (69.61%), Query Frame = 1
BLAST of Cucsa.126860 vs. TAIR10
Match: AT1G28370.1 (AT1G28370.1 ERF domain protein 11) HSP 1 Score: 109.0 bits (271), Expect = 2.8e-24 Identity = 76/167 (45.51%), Postives = 90/167 (53.89%), Query Frame = 1
BLAST of Cucsa.126860 vs. NCBI nr
Match: gi|449457761|ref|XP_004146616.1| (PREDICTED: ethylene-responsive transcription factor 12 [Cucumis sativus]) HSP 1 Score: 336.7 bits (862), Expect = 2.3e-89 Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 1
BLAST of Cucsa.126860 vs. NCBI nr
Match: gi|659068110|ref|XP_008442801.1| (PREDICTED: ethylene-responsive transcription factor 12 [Cucumis melo]) HSP 1 Score: 313.2 bits (801), Expect = 2.7e-82 Identity = 154/162 (95.06%), Postives = 156/162 (96.30%), Query Frame = 1
BLAST of Cucsa.126860 vs. NCBI nr
Match: gi|802786336|ref|XP_012091650.1| (PREDICTED: ethylene-responsive transcription factor 12 [Jatropha curcas]) HSP 1 Score: 191.0 bits (484), Expect = 1.6e-45 Identity = 103/171 (60.23%), Postives = 115/171 (67.25%), Query Frame = 1
BLAST of Cucsa.126860 vs. NCBI nr
Match: gi|1009109495|ref|XP_015890508.1| (PREDICTED: ethylene-responsive transcription factor 12 [Ziziphus jujuba]) HSP 1 Score: 189.9 bits (481), Expect = 3.5e-45 Identity = 108/176 (61.36%), Postives = 119/176 (67.61%), Query Frame = 1
BLAST of Cucsa.126860 vs. NCBI nr
Match: gi|1000983453|ref|XP_015584131.1| (PREDICTED: ethylene-responsive transcription factor 12 [Ricinus communis]) HSP 1 Score: 188.3 bits (477), Expect = 1.0e-44 Identity = 101/169 (59.76%), Postives = 115/169 (68.05%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: The following gene(s) are paralogous to this gene:
The following block(s) are covering this gene: |