Cucsa.119770 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GTGTTGCTTGGTCTCTCAGGAGTTATACTTGTTGTGCTGTCTGTTCTAGGATCTATAGGATTCTTCAGTGCCATTGGAATAAAATCAACACTAATAATTATGGAGGTTATTCCATTTCTGGTGTTGGCGGTAAGTAATTTTGATGCTTTGAAGTTTCTACTTTTCTTTCAATTCTCTTGAGTTCAGTCTTTGTTACATTAAACGGCAGTAAAGTACGATAATGACTATATTTTTGTTGTTTAGTTTTCCCATTGTGTCGTAAGATAG GTGTTGCTTGGTCTCTCAGGAGTTATACTTGTTGTGCTGTCTGTTCTAGGATCTATAGGATTCTTCAGTGCCATTGGAATAAAATCAACACTAATAATTATGGAGGTTATTCCATTTCTGGTGTTGGCGTTTTCCCATTGTGTCGTAAGATAG GTGTTGCTTGGTCTCTCAGGAGTTATACTTGTTGTGCTGTCTGTTCTAGGATCTATAGGATTCTTCAGTGCCATTGGAATAAAATCAACACTAATAATTATGGAGGTTATTCCATTTCTGGTGTTGGCGTTTTCCCATTGTGTCGTAAGATAG VLLGLSGVILVVLSVLGSIGFFSAIGIKSTLIIMEVIPFLVLAFSHCVVR*
BLAST of Cucsa.119770 vs. Swiss-Prot
Match: NPC1_YEAST (Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 7.7e-07 Identity = 24/43 (55.81%), Postives = 36/43 (83.72%), Query Frame = 1
BLAST of Cucsa.119770 vs. Swiss-Prot
Match: NPC1_PIG (Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 2.3e-06 Identity = 24/43 (55.81%), Postives = 35/43 (81.40%), Query Frame = 1
BLAST of Cucsa.119770 vs. Swiss-Prot
Match: NPCL1_RAT (Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 2.3e-06 Identity = 23/41 (56.10%), Postives = 36/41 (87.80%), Query Frame = 1
BLAST of Cucsa.119770 vs. Swiss-Prot
Match: NPC1_HUMAN (Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2) HSP 1 Score: 51.6 bits (122), Expect = 2.9e-06 Identity = 25/43 (58.14%), Postives = 35/43 (81.40%), Query Frame = 1
BLAST of Cucsa.119770 vs. Swiss-Prot
Match: NPCL1_HUMAN (Niemann-Pick C1-like protein 1 OS=Homo sapiens GN=NPC1L1 PE=1 SV=2) HSP 1 Score: 51.2 bits (121), Expect = 3.8e-06 Identity = 22/41 (53.66%), Postives = 36/41 (87.80%), Query Frame = 1
BLAST of Cucsa.119770 vs. TrEMBL
Match: V4S5N4_9ROSI (Uncharacterized protein (Fragment) OS=Citrus clementina GN=CICLE_v100301201mg PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 4.3e-12 Identity = 40/43 (93.02%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. TrEMBL
Match: M5W6J9_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000346mg PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 4.3e-12 Identity = 40/43 (93.02%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. TrEMBL
Match: A0A067FY06_CITSI (Uncharacterized protein (Fragment) OS=Citrus sinensis GN=CISIN_1g0072031mg PE=4 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 4.3e-12 Identity = 40/43 (93.02%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. TrEMBL
Match: A0A067H2F8_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000762mg PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 5.6e-12 Identity = 39/43 (90.70%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. TrEMBL
Match: A0A067GZS7_CITSI (Uncharacterized protein OS=Citrus sinensis GN=CISIN_1g000762mg PE=4 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 5.6e-12 Identity = 39/43 (90.70%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. TAIR10
Match: AT1G42470.1 (AT1G42470.1 Patched family protein) HSP 1 Score: 75.9 bits (185), Expect = 8.2e-15 Identity = 38/43 (88.37%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. TAIR10
Match: AT4G38350.2 (AT4G38350.2 Patched family protein) HSP 1 Score: 73.9 bits (180), Expect = 3.1e-14 Identity = 37/43 (86.05%), Postives = 42/43 (97.67%), Query Frame = 1
BLAST of Cucsa.119770 vs. NCBI nr
Match: gi|778712664|ref|XP_011656917.1| (PREDICTED: Niemann-Pick C1 protein isoform X1 [Cucumis sativus]) HSP 1 Score: 79.7 bits (195), Expect = 1.6e-12 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. NCBI nr
Match: gi|778712679|ref|XP_011656920.1| (PREDICTED: Niemann-Pick C1 protein isoform X2 [Cucumis sativus]) HSP 1 Score: 79.7 bits (195), Expect = 1.6e-12 Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. NCBI nr
Match: gi|659094691|ref|XP_008448193.1| (PREDICTED: Niemann-Pick C1 protein-like isoform X1 [Cucumis melo]) HSP 1 Score: 79.3 bits (194), Expect = 2.1e-12 Identity = 42/43 (97.67%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. NCBI nr
Match: gi|659094693|ref|XP_008448194.1| (PREDICTED: Niemann-Pick C1 protein-like isoform X2 [Cucumis melo]) HSP 1 Score: 79.3 bits (194), Expect = 2.1e-12 Identity = 42/43 (97.67%), Postives = 43/43 (100.00%), Query Frame = 1
BLAST of Cucsa.119770 vs. NCBI nr
Match: gi|595796963|ref|XP_007201221.1| (hypothetical protein PRUPE_ppa000346mg [Prunus persica]) HSP 1 Score: 77.8 bits (190), Expect = 6.1e-12 Identity = 40/43 (93.02%), Postives = 43/43 (100.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|