Cucsa.117970 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.AGAAGAAGAATTACACTCCAAATCAAAACACAGCAAAAGTTTAAGCTTTGAGAAAATTAAAATTAATTTTAAGTTTGTGAAAGAGAGAAAAATGGCTTCTGGATGCAAATGTGGTGACAATTGCTCATGTGGAGATAGCTGCAACTGCCAATCAGGGTCCGTCATCCTCAAGCAGTAAGTAATAAGTTTTTCTAGTGTTGTTTTAGAATTAAGTATATGGTTAAATATGAATAAAAAACTCAAAACTAAGTATTATATATGAGTATATATCAAAGTTATATTGAATGAAATAATAATTTAGAAAATGGTTTGATTGAGAATGCAGAAGTGGATGCAGCTGTGGGGATAGCTGCTCATGTGACCCATGCAGCTGCAAATGA AGAAGAAGAATTACACTCCAAATCAAAACACAGCAAAAGTTTAAGCTTTGAGAAAATTAAAATTAATTTTAAGTTTGTGAAAGAGAGAAAAATGGCTTCTGGATGCAAATGTGGTGACAATTGCTCATGTGGAGATAGCTGCAACTGCCAATCAGGGTCCGTCATCCTCAAGCAAAGTGGATGCAGCTGTGGGGATAGCTGCTCATGTGACCCATGCAGCTGCAAATGA AGAAGAAGAATTACACTCCAAATCAAAACACAGCAAAAGTTTAAGCTTTGAGAAAATTAAAATTAATTTTAAGTTTGTGAAAGAGAGAAAAATGGCTTCTGGATGCAAATGTGGTGACAATTGCTCATGTGGAGATAGCTGCAACTGCCAATCAGGGTCCGTCATCCTCAAGCAAAGTGGATGCAGCTGTGGGGATAGCTGCTCATGTGACCCATGCAGCTGCAAATGA EEELHSKSKHSKSLSFEKIKINFKFVKERKMASGCKCGDNCSCGDSCNCQSGSVILKQSGCSCGDSCSCDPCSCK*
BLAST of Cucsa.117970 vs. Swiss-Prot
Match: MT1B_VICFA (Metallothionein-like protein 1B OS=Vicia faba GN=MT1B PE=3 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.2e-09 Identity = 29/74 (39.19%), Postives = 35/74 (47.30%), Query Frame = 1
HSP 2 Score: 37.7 bits (86), Expect = 6.5e-02 Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 1
BLAST of Cucsa.117970 vs. Swiss-Prot
Match: MT1_TRIRP (Metallothionein-like protein 1 OS=Trifolium repens GN=MT1B PE=3 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 9.4e-09 Identity = 27/74 (36.49%), Postives = 32/74 (43.24%), Query Frame = 1
BLAST of Cucsa.117970 vs. Swiss-Prot
Match: MT1_PEA (Metallothionein-like protein 1 OS=Pisum sativum GN=MTA PE=3 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 2.7e-08 Identity = 28/74 (37.84%), Postives = 34/74 (45.95%), Query Frame = 1
BLAST of Cucsa.117970 vs. Swiss-Prot
Match: MT1A_VICFA (Metallothionein-like protein 1A OS=Vicia faba GN=MT1A PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.7e-08 Identity = 28/76 (36.84%), Postives = 33/76 (43.42%), Query Frame = 1
BLAST of Cucsa.117970 vs. Swiss-Prot
Match: MT1_CICAR (Metallothionein-like protein 1 OS=Cicer arietinum PE=3 SV=1) HSP 1 Score: 58.2 bits (139), Expect = 4.7e-08 Identity = 27/74 (36.49%), Postives = 33/74 (44.59%), Query Frame = 1
BLAST of Cucsa.117970 vs. TrEMBL
Match: O81529_MESCR (Metallothionein OS=Mesembryanthemum crystallinum PE=2 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.3e-09 Identity = 26/40 (65.00%), Postives = 27/40 (67.50%), Query Frame = 1
BLAST of Cucsa.117970 vs. TrEMBL
Match: O81529_MESCR (Metallothionein OS=Mesembryanthemum crystallinum PE=2 SV=1) HSP 1 Score: 34.3 bits (77), Expect = 8.1e+01 Identity = 13/20 (65.00%), Postives = 14/20 (70.00%), Query Frame = 1
HSP 2 Score: 67.8 bits (164), Expect = 6.6e-09 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = 1
BLAST of Cucsa.117970 vs. TrEMBL
Match: A0A0J8BVT6_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_7g173880 PE=4 SV=1) HSP 1 Score: 67.4 bits (163), Expect = 8.6e-09 Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = 1
BLAST of Cucsa.117970 vs. TrEMBL
Match: O81528_MESCR (Metallothionein OS=Mesembryanthemum crystallinum PE=2 SV=1) HSP 1 Score: 65.9 bits (159), Expect = 2.5e-08 Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 1
BLAST of Cucsa.117970 vs. TrEMBL
Match: A0A0J8C7E6_BETVU (Uncharacterized protein OS=Beta vulgaris subsp. vulgaris GN=BVRB_6g129570 PE=4 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 4.3e-08 Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = 1
BLAST of Cucsa.117970 vs. NCBI nr
Match: gi|3342196|gb|AAC27530.1| (metallothionein [Mesembryanthemum crystallinum]) HSP 1 Score: 70.1 bits (170), Expect = 1.9e-09 Identity = 26/40 (65.00%), Postives = 27/40 (67.50%), Query Frame = 1
BLAST of Cucsa.117970 vs. NCBI nr
Match: gi|3342196|gb|AAC27530.1| (metallothionein [Mesembryanthemum crystallinum]) HSP 1 Score: 34.3 bits (77), Expect = 1.2e+02 Identity = 13/20 (65.00%), Postives = 14/20 (70.00%), Query Frame = 1
HSP 2 Score: 67.8 bits (164), Expect = 9.4e-09 Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = 1
BLAST of Cucsa.117970 vs. NCBI nr
Match: gi|870853366|gb|KMT05247.1| (hypothetical protein BVRB_7g173880 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 67.4 bits (163), Expect = 1.2e-08 Identity = 24/40 (60.00%), Postives = 28/40 (70.00%), Query Frame = 1
BLAST of Cucsa.117970 vs. NCBI nr
Match: gi|3342194|gb|AAC27529.1| (metallothionein [Mesembryanthemum crystallinum]) HSP 1 Score: 65.9 bits (159), Expect = 3.6e-08 Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 1
BLAST of Cucsa.117970 vs. NCBI nr
Match: gi|870857961|gb|KMT09487.1| (hypothetical protein BVRB_6g129570 [Beta vulgaris subsp. vulgaris]) HSP 1 Score: 65.1 bits (157), Expect = 6.1e-08 Identity = 23/40 (57.50%), Postives = 28/40 (70.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: None |