Cucsa.108540 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.CTTGTTTTTGCTGTCTTCACTGGAGAGTCCTGGGGTTACCTTGGTAGTAGGAGATTTTTGCTTGAACTTGATTTACAGTCTGATGCTGTCAGTGGCCTCGAAAATAGATTAATTGATACGGTATACTACTGA CTTGTTTTTGCTGTCTTCACTGGAGAGTCCTGGGGTTACCTTGGTAGTAGGAGATTTTTGCTTGAACTTGATTTACAGTCTGATGCTGTCAGTGGCCTCGAAAATAGATTAATTGATACGGTATACTACTGA CTTGTTTTTGCTGTCTTCACTGGAGAGTCCTGGGGTTACCTTGGTAGTAGGAGATTTTTGCTTGAACTTGATTTACAGTCTGATGCTGTCAGTGGCCTCGAAAATAGATTAATTGATACGGTATACTACTGA LVFAVFTGESWGYLGSRRFLLELDLQSDAVSGLENRLIDTVYY*
BLAST of Cucsa.108540 vs. Swiss-Prot
Match: NICA_ARATH (Nicastrin OS=Arabidopsis thaliana GN=At3g52640/At3g52650 PE=2 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 3.8e-10 Identity = 31/41 (75.61%), Postives = 34/41 (82.93%), Query Frame = 1
BLAST of Cucsa.108540 vs. TrEMBL
Match: W9SA84_9ROSA (Uncharacterized protein OS=Morus notabilis GN=L484_004947 PE=4 SV=1) HSP 1 Score: 74.3 bits (181), Expect = 4.1e-11 Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 1
BLAST of Cucsa.108540 vs. TrEMBL
Match: A0A067JSP2_JATCU (Uncharacterized protein OS=Jatropha curcas GN=JCGZ_22540 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 1.2e-10 Identity = 33/41 (80.49%), Postives = 40/41 (97.56%), Query Frame = 1
BLAST of Cucsa.108540 vs. TrEMBL
Match: M1B118_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400013310 PE=4 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 1.5e-10 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 1
BLAST of Cucsa.108540 vs. TrEMBL
Match: M1B119_SOLTU (Uncharacterized protein OS=Solanum tuberosum GN=PGSC0003DMG400013310 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.0e-09 Identity = 34/41 (82.93%), Postives = 37/41 (90.24%), Query Frame = 1
BLAST of Cucsa.108540 vs. TrEMBL
Match: B9H3E1_POPTR (Nicastrin-related family protein OS=Populus trichocarpa GN=POPTR_0004s08120g PE=4 SV=2) HSP 1 Score: 69.3 bits (168), Expect = 1.3e-09 Identity = 32/41 (78.05%), Postives = 38/41 (92.68%), Query Frame = 1
BLAST of Cucsa.108540 vs. TAIR10
Match: AT3G52640.2 (AT3G52640.2 Zn-dependent exopeptidases superfamily protein) HSP 1 Score: 64.3 bits (155), Expect = 2.1e-11 Identity = 31/41 (75.61%), Postives = 34/41 (82.93%), Query Frame = 1
BLAST of Cucsa.108540 vs. NCBI nr
Match: gi|449445945|ref|XP_004140732.1| (PREDICTED: nicastrin [Cucumis sativus]) HSP 1 Score: 84.7 bits (208), Expect = 4.3e-14 Identity = 41/42 (97.62%), Postives = 42/42 (100.00%), Query Frame = 1
BLAST of Cucsa.108540 vs. NCBI nr
Match: gi|659114563|ref|XP_008457115.1| (PREDICTED: nicastrin isoform X1 [Cucumis melo]) HSP 1 Score: 79.0 bits (193), Expect = 2.4e-12 Identity = 38/42 (90.48%), Postives = 39/42 (92.86%), Query Frame = 1
BLAST of Cucsa.108540 vs. NCBI nr
Match: gi|659114565|ref|XP_008457117.1| (PREDICTED: nicastrin isoform X2 [Cucumis melo]) HSP 1 Score: 77.8 bits (190), Expect = 5.3e-12 Identity = 38/41 (92.68%), Postives = 38/41 (92.68%), Query Frame = 1
BLAST of Cucsa.108540 vs. NCBI nr
Match: gi|703126013|ref|XP_010103453.1| (hypothetical protein L484_004947 [Morus notabilis]) HSP 1 Score: 74.3 bits (181), Expect = 5.8e-11 Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 1
BLAST of Cucsa.108540 vs. NCBI nr
Match: gi|643712557|gb|KDP25818.1| (hypothetical protein JCGZ_22540 [Jatropha curcas]) HSP 1 Score: 72.8 bits (177), Expect = 1.7e-10 Identity = 33/41 (80.49%), Postives = 40/41 (97.56%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|