Cucsa.059710 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATTGTTCGATCCCGAGAGGCATTTTGGGCGCATATCACAGCAACCCAATAAATATTTTCATTCATATTCTCTTTGTTTGGGCTATCTTCTTCACTATGCTCATGCTTTTCTATTATACCCCTTTCTTTTACTCTTTTTCCAAATGCCCTTGTGGCTTCAATACTGGCTTTGTTTTGAAGT ATGGATTGTTCGATCCCGAGAGGCATTTTGGGCGCATATCACAGCAACCCAATAAATATTTTCATTCATATTCTCTTTGTTTGGGCTATCTTCTTCACTATGCTCATGCTTTTCTATTATACCCCTTTCTTTTACTCTTTTTCCAAATGCCCTTGTGGCTTCAATACTGGCTTTGTTTTGAAGT ATGGATTGTTCGATCCCGAGAGGCATTTTGGGCGCATATCACAGCAACCCAATAAATATTTTCATTCATATTCTCTTTGTTTGGGCTATCTTCTTCACTATGCTCATGCTTTTCTATTATACCCCTTTCTTTTACTCTTTTTCCAAATGCCCTTGTGGCTTCAATACTGGCTTTGTTTTGAAGT MDCSIPRGILGAYHSNPINIFIHILFVWAIFFTMLMLFYYTPFFYSFSKCPCGFNTGFVLKX
BLAST of Cucsa.059710 vs. TrEMBL
Match: A0A0A0LQ68_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G038330 PE=4 SV=1) HSP 1 Score: 101.7 bits (252), Expect = 3.4e-19 Identity = 45/50 (90.00%), Postives = 45/50 (90.00%), Query Frame = 1
BLAST of Cucsa.059710 vs. TrEMBL
Match: A0A0A0LP54_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_1G009840 PE=4 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-13 Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = 1
BLAST of Cucsa.059710 vs. TrEMBL
Match: A5B816_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_019656 PE=4 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.4e-09 Identity = 29/53 (54.72%), Postives = 39/53 (73.58%), Query Frame = 1
BLAST of Cucsa.059710 vs. TrEMBL
Match: A0A0B0NNJ9_GOSAR (Putative endoplasmic reticulum membrane C16E8.02 OS=Gossypium arboreum GN=F383_05908 PE=4 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.4e-09 Identity = 32/48 (66.67%), Postives = 36/48 (75.00%), Query Frame = 1
BLAST of Cucsa.059710 vs. TrEMBL
Match: F6GT68_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_17s0000g06380 PE=4 SV=1) HSP 1 Score: 68.6 bits (166), Expect = 3.1e-09 Identity = 29/53 (54.72%), Postives = 39/53 (73.58%), Query Frame = 1
BLAST of Cucsa.059710 vs. TAIR10
Match: AT1G18720.1 (AT1G18720.1 Protein of unknown function (DUF962)) HSP 1 Score: 54.3 bits (129), Expect = 3.1e-08 Identity = 31/59 (52.54%), Postives = 38/59 (64.41%), Query Frame = 1
BLAST of Cucsa.059710 vs. TAIR10
Match: AT1G74440.1 (AT1G74440.1 Protein of unknown function (DUF962)) HSP 1 Score: 48.9 bits (115), Expect = 1.3e-06 Identity = 21/32 (65.62%), Postives = 22/32 (68.75%), Query Frame = 1
BLAST of Cucsa.059710 vs. NCBI nr
Match: gi|659066423|ref|XP_008444013.1| (PREDICTED: uncharacterized endoplasmic reticulum membrane protein YGL010W-like [Cucumis melo]) HSP 1 Score: 101.7 bits (252), Expect = 4.8e-19 Identity = 45/50 (90.00%), Postives = 45/50 (90.00%), Query Frame = 1
BLAST of Cucsa.059710 vs. NCBI nr
Match: gi|778656883|ref|XP_004137417.2| (PREDICTED: uncharacterized endoplasmic reticulum membrane protein YGL010W [Cucumis sativus]) HSP 1 Score: 101.7 bits (252), Expect = 4.8e-19 Identity = 45/50 (90.00%), Postives = 45/50 (90.00%), Query Frame = 1
BLAST of Cucsa.059710 vs. NCBI nr
Match: gi|659105955|ref|XP_008453216.1| (PREDICTED: uncharacterized endoplasmic reticulum membrane protein YGL010W [Cucumis melo]) HSP 1 Score: 83.2 bits (204), Expect = 1.8e-13 Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = 1
BLAST of Cucsa.059710 vs. NCBI nr
Match: gi|449440804|ref|XP_004138174.1| (PREDICTED: uncharacterized endoplasmic reticulum membrane protein YGL010W [Cucumis sativus]) HSP 1 Score: 83.2 bits (204), Expect = 1.8e-13 Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = 1
BLAST of Cucsa.059710 vs. NCBI nr
Match: gi|1000976247|ref|XP_015572079.1| (PREDICTED: uncharacterized endoplasmic reticulum membrane protein C16E8.02 [Ricinus communis]) HSP 1 Score: 69.7 bits (169), Expect = 2.0e-09 Identity = 31/50 (62.00%), Postives = 37/50 (74.00%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|