Cucsa.032750 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTGAAAAACAGAGCTGCGCTTCCCATTGCTTCATTAAGAGGTGATATGTTGCGTCTCCTGAAGGAGAATAATGTTCTTGTTGTTTGCGGGGATACAGGTTCTGGAAAGACAACTCAGGTTCATTTGTTTCAAGTGCAATTATTCCTATATTATTGTATTTTCTCTAAAGAAGAAAAAAAaTTAATGAATAGGTGATTTCACCAATACCTAGTTCATGAAATAGTACTTATTAACGGTATATGGGTAAGATTTGTAGGGATATTAGTTTGGGGTATTATGGGCAATTAGCTAGTGGTGTCTTGGTTTTAAATAAGAGGAGTTGTTCACCTTAGAGGATGTGAATCATTTCGGTAGGATTTTTCTTTGACGGAATTTGGGAAAGAGATTGCCCTCACGTAAGGCTATTTTTCTTTAAATTGTTTATTGATATTTTGGTGTTTCTTTTAAGTATTTTTGTTAGATAATATCCTAACATTATTTtCCCCTTTTAATGTGCTCTGCTCGACTGCATTAATAGCACATATACAAAATGTTTCTCCTAAGATCTTACCCTTATTTTTCTCTTGAAGATTTCTCTAACAATTGTTTTATGTAGGTCCCACAATTTATACTGGATGAGATGATCGAATCAGGATGTGGAGGACTGTGCAACATAGTATGCACACAACCAAGAAGAATAGCG ATGTTGAAAAACAGAGCTGCGCTTCCCATTGCTTCATTAAGAGGTGATATGTTGCGTCTCCTGAAGGAGAATAATGTTCTTGTTGTTTGCGGGGATACAGGTTCTGGAAAGACAACTCAGGTCCCACAATTTATACTGGATGAGATGATCGAATCAGGATGTGGAGGACTGTGCAACATAGTATGCACACAACCAAGAAGAATAGCG ATGTTGAAAAACAGAGCTGCGCTTCCCATTGCTTCATTAAGAGGTGATATGTTGCGTCTCCTGAAGGAGAATAATGTTCTTGTTGTTTGCGGGGATACAGGTTCTGGAAAGACAACTCAGGTCCCACAATTTATACTGGATGAGATGATCGAATCAGGATGTGGAGGACTGTGCAACATAGTATGCACACAACCAAGAAGAATAGCG MLKNRAALPIASLRGDMLRLLKENNVLVVCGDTGSGKTTQVPQFILDEMIESGCGGLCNIVCTQPRRIA
BLAST of Cucsa.032750 vs. Swiss-Prot
Match: DEXH4_ARATH (DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 8.0e-23 Identity = 50/68 (73.53%), Postives = 60/68 (88.24%), Query Frame = 1
BLAST of Cucsa.032750 vs. Swiss-Prot
Match: DEXH7_ARATH (DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 8.0e-23 Identity = 50/69 (72.46%), Postives = 60/69 (86.96%), Query Frame = 1
BLAST of Cucsa.032750 vs. Swiss-Prot
Match: YUM14_USTMA (Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1) HSP 1 Score: 83.2 bits (204), Expect = 1.2e-15 Identity = 39/69 (56.52%), Postives = 52/69 (75.36%), Query Frame = 1
BLAST of Cucsa.032750 vs. Swiss-Prot
Match: DHX29_MOUSE (ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-13 Identity = 36/70 (51.43%), Postives = 50/70 (71.43%), Query Frame = 1
BLAST of Cucsa.032750 vs. Swiss-Prot
Match: DHX29_XENLA (ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.6e-13 Identity = 36/70 (51.43%), Postives = 51/70 (72.86%), Query Frame = 1
BLAST of Cucsa.032750 vs. TrEMBL
Match: A0A0A0L6M0_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G228870 PE=4 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 3.3e-31 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Cucsa.032750 vs. TrEMBL
Match: A0A061DXK0_THECC (ATP-dependent RNA helicase, putative isoform 3 OS=Theobroma cacao GN=TCM_006225 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 4.6e-25 Identity = 59/69 (85.51%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Cucsa.032750 vs. TrEMBL
Match: A0A061DYH6_THECC (ATP-dependent RNA helicase, putative isoform 1 OS=Theobroma cacao GN=TCM_006225 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 4.6e-25 Identity = 59/69 (85.51%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Cucsa.032750 vs. TrEMBL
Match: A0A061E4D8_THECC (ATP-dependent RNA helicase, putative isoform 4 OS=Theobroma cacao GN=TCM_006225 PE=4 SV=1) HSP 1 Score: 121.3 bits (303), Expect = 4.6e-25 Identity = 59/69 (85.51%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Cucsa.032750 vs. TrEMBL
Match: M5XY08_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa000230mg PE=4 SV=1) HSP 1 Score: 120.9 bits (302), Expect = 5.9e-25 Identity = 58/69 (84.06%), Postives = 64/69 (92.75%), Query Frame = 1
BLAST of Cucsa.032750 vs. TAIR10
Match: AT1G58050.1 (AT1G58050.1 RNA helicase family protein) HSP 1 Score: 107.1 bits (266), Expect = 4.5e-24 Identity = 50/68 (73.53%), Postives = 60/68 (88.24%), Query Frame = 1
BLAST of Cucsa.032750 vs. TAIR10
Match: AT1G58060.1 (AT1G58060.1 RNA helicase family protein) HSP 1 Score: 107.1 bits (266), Expect = 4.5e-24 Identity = 50/69 (72.46%), Postives = 60/69 (86.96%), Query Frame = 1
BLAST of Cucsa.032750 vs. TAIR10
Match: AT5G04895.1 (AT5G04895.1 DEA(D/H)-box RNA helicase family protein) HSP 1 Score: 78.2 bits (191), Expect = 2.2e-15 Identity = 37/69 (53.62%), Postives = 49/69 (71.01%), Query Frame = 1
BLAST of Cucsa.032750 vs. TAIR10
Match: AT2G01130.1 (AT2G01130.1 DEA(D/H)-box RNA helicase family protein) HSP 1 Score: 75.1 bits (183), Expect = 1.9e-14 Identity = 34/69 (49.28%), Postives = 48/69 (69.57%), Query Frame = 1
BLAST of Cucsa.032750 vs. TAIR10
Match: AT2G35920.1 (AT2G35920.1 RNA helicase family protein) HSP 1 Score: 75.1 bits (183), Expect = 1.9e-14 Identity = 36/65 (55.38%), Postives = 46/65 (70.77%), Query Frame = 1
BLAST of Cucsa.032750 vs. NCBI nr
Match: gi|778680313|ref|XP_011651287.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis sativus]) HSP 1 Score: 141.7 bits (356), Expect = 4.7e-31 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Cucsa.032750 vs. NCBI nr
Match: gi|700202477|gb|KGN57610.1| (hypothetical protein Csa_3G228870 [Cucumis sativus]) HSP 1 Score: 141.7 bits (356), Expect = 4.7e-31 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Cucsa.032750 vs. NCBI nr
Match: gi|778680315|ref|XP_011651288.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis sativus]) HSP 1 Score: 141.7 bits (356), Expect = 4.7e-31 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 1
BLAST of Cucsa.032750 vs. NCBI nr
Match: gi|659112042|ref|XP_008456037.1| (PREDICTED: ATP-dependent RNA helicase DHX36 isoform X2 [Cucumis melo]) HSP 1 Score: 138.7 bits (348), Expect = 4.0e-30 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
BLAST of Cucsa.032750 vs. NCBI nr
Match: gi|659112040|ref|XP_008456036.1| (PREDICTED: ATP-dependent RNA helicase DHX29 isoform X1 [Cucumis melo]) HSP 1 Score: 138.7 bits (348), Expect = 4.0e-30 Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|