Cucsa.031420 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.GAGTTAAAGCTATTTTTTTGTCCATATCTTTATTTGCTTTGCTGGTTCGATTGGCAGTCTCCCTTCATCCTTACTCGGGTGCTGGGAACCCTCCTAAGTATGGTGACTATGAGGCACAGAGGCATTGGATGGAAATCACCATCAACCTTCCAGCTAAGGACTGGTACATGAACAGTACCACAAATGACCTCAACTATTGGGGACTTGATTATCCACCCCTAACAGCCTATCAGAGTTTCATTCATGGTCTTTTCCTCAAGTTATTTGATTCAGATTCAGTTTCACTGTTTACTTCGCGAGGTTATGAGTCCTATTTTGGGTGA GAGTTAAAGCTATTTTTTTGTCCATATCTTTATTTGCTTTGCTGGTTCGATTGGCAGTCTCCCTTCATCCTTACTCGGGTGCTGGGAACCCTCCTAAGTATGGTGACTATGAGGCACAGAGGCATTGGATGGAAATCACCATCAACCTTCCAGCTAAGGACTGGTACATGAACAGTACCACAAATGACCTCAACTATTGGGGACTTGATTATCCACCCCTAACAGCCTATCAGAGTTTCATTCATGGTCTTTTCCTCAAGTTATTTGATTCAGATTCAGTTTCACTGTTTACTTCGCGAGGTTATGAGTCCTATTTTGGGTGA GAGTTAAAGCTATTTTTTTGTCCATATCTTTATTTGCTTTGCTGGTTCGATTGGCAGTCTCCCTTCATCCTTACTCGGGTGCTGGGAACCCTCCTAAGTATGGTGACTATGAGGCACAGAGGCATTGGATGGAAATCACCATCAACCTTCCAGCTAAGGACTGGTACATGAACAGTACCACAAATGACCTCAACTATTGGGGACTTGATTATCCACCCCTAACAGCCTATCAGAGTTTCATTCATGGTCTTTTCCTCAAGTTATTTGATTCAGATTCAGTTTCACTGTTTACTTCGCGAGGTTATGAGTCCTATTTTGGGTGA VKAIFLSISLFALLVRLAVSLHPYSGAGNPPKYGDYEAQRHWMEITINLPAKDWYMNSTTNDLNYWGLDYPPLTAYQSFIHGLFLKLFDSDSVSLFTSRGYESYFG*
BLAST of Cucsa.031420 vs. Swiss-Prot
Match: ALG6_ARATH (Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Arabidopsis thaliana GN=At5g38460 PE=2 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 5.9e-41 Identity = 74/102 (72.55%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Cucsa.031420 vs. Swiss-Prot
Match: ALG6_RAT (Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Rattus norvegicus GN=Alg6 PE=2 SV=1) HSP 1 Score: 132.1 bits (331), Expect = 3.6e-30 Identity = 60/96 (62.50%), Postives = 69/96 (71.88%), Query Frame = 1
BLAST of Cucsa.031420 vs. Swiss-Prot
Match: ALG6_CHICK (Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus GN=ALG6 PE=2 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 4.7e-30 Identity = 60/94 (63.83%), Postives = 69/94 (73.40%), Query Frame = 1
BLAST of Cucsa.031420 vs. Swiss-Prot
Match: ALG6_HUMAN (Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens GN=ALG6 PE=1 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 8.0e-30 Identity = 59/96 (61.46%), Postives = 68/96 (70.83%), Query Frame = 1
BLAST of Cucsa.031420 vs. Swiss-Prot
Match: ALG6_MOUSE (Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus GN=Alg6 PE=2 SV=1) HSP 1 Score: 130.2 bits (326), Expect = 1.4e-29 Identity = 60/96 (62.50%), Postives = 68/96 (70.83%), Query Frame = 1
BLAST of Cucsa.031420 vs. TrEMBL
Match: A0A0A0L7G4_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_3G271410 PE=4 SV=1) HSP 1 Score: 224.6 bits (571), Expect = 5.9e-56 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Cucsa.031420 vs. TrEMBL
Match: D7TT36_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VIT_14s0006g03000 PE=4 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 6.6e-47 Identity = 86/106 (81.13%), Postives = 98/106 (92.45%), Query Frame = 1
BLAST of Cucsa.031420 vs. TrEMBL
Match: A5BMD9_VITVI (Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_024987 PE=4 SV=1) HSP 1 Score: 194.5 bits (493), Expect = 6.6e-47 Identity = 86/106 (81.13%), Postives = 98/106 (92.45%), Query Frame = 1
BLAST of Cucsa.031420 vs. TrEMBL
Match: A0A0K9RNA8_SPIOL (Uncharacterized protein OS=Spinacia oleracea GN=SOVF_053420 PE=4 SV=1) HSP 1 Score: 190.3 bits (482), Expect = 1.2e-45 Identity = 87/104 (83.65%), Postives = 95/104 (91.35%), Query Frame = 1
BLAST of Cucsa.031420 vs. TrEMBL
Match: M5XQL1_PRUPE (Uncharacterized protein OS=Prunus persica GN=PRUPE_ppa004184mg PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 1.6e-45 Identity = 84/106 (79.25%), Postives = 96/106 (90.57%), Query Frame = 1
BLAST of Cucsa.031420 vs. TAIR10
Match: AT5G38460.1 (AT5G38460.1 ALG6, ALG8 glycosyltransferase family) HSP 1 Score: 167.9 bits (424), Expect = 3.3e-42 Identity = 74/102 (72.55%), Postives = 88/102 (86.27%), Query Frame = 1
BLAST of Cucsa.031420 vs. NCBI nr
Match: gi|449455842|ref|XP_004145659.1| (PREDICTED: probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase [Cucumis sativus]) HSP 1 Score: 224.6 bits (571), Expect = 8.5e-56 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Cucsa.031420 vs. NCBI nr
Match: gi|700202615|gb|KGN57748.1| (hypothetical protein Csa_3G271410 [Cucumis sativus]) HSP 1 Score: 224.6 bits (571), Expect = 8.5e-56 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 1
BLAST of Cucsa.031420 vs. NCBI nr
Match: gi|659133681|ref|XP_008466856.1| (PREDICTED: probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase, partial [Cucumis melo]) HSP 1 Score: 213.0 bits (541), Expect = 2.6e-52 Identity = 99/106 (93.40%), Postives = 102/106 (96.23%), Query Frame = 1
BLAST of Cucsa.031420 vs. NCBI nr
Match: gi|147854062|emb|CAN83394.1| (hypothetical protein VITISV_024987 [Vitis vinifera]) HSP 1 Score: 194.5 bits (493), Expect = 9.4e-47 Identity = 86/106 (81.13%), Postives = 98/106 (92.45%), Query Frame = 1
BLAST of Cucsa.031420 vs. NCBI nr
Match: gi|225452021|ref|XP_002280181.1| (PREDICTED: probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase isoform X1 [Vitis vinifera]) HSP 1 Score: 194.5 bits (493), Expect = 9.4e-47 Identity = 86/106 (81.13%), Postives = 98/106 (92.45%), Query Frame = 1
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|