Cucsa.018130 (gene) Cucumber (Gy14) v1
The following sequences are available for this feature:
Legend: CDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGGAAATACAGGTGATGAATCTGCATTCAGTTACAATGAGGGAAATGGAAATGGACCAAAAGAATGGGGAAAGCTAAAAGCAGATTGGAAATCTTGTGAGGAAGGGAAGTATCAGTCTCCCATTAATATTGTTGAAGAAGATGTTCAAGTTCTTCCTAAGCTTGGAAAACTTAGAAGGGATTACAATCCTGCTCCCGCTATCGTCAAGAATCGAGGACACGACATTTTGGTAATATTCGTCTCATCATTCATTATTTTCTTTGTTTCATATATATCATCCAATACTTGTAGTTTTACTCTAATATGTTTGTATGTTTGTGAATGA ATGGTTGGAAATACAGGTGATGAATCTGCATTCAGTTACAATGAGGGAAATGGAAATGGACCAAAAGAATGGGGAAAGCTAAAAGCAGATTGGAAATCTTGTGAGGAAGGGAAGTATCAGTCTCCCATTAATATTGTTGAAGAAGATGTTCAAGTTCTTCCTAAGCTTGGAAAACTTAGAAGGGATTACAATCCTGCTCCCGCTATCGTCAAGAATCGAGGACACGACATTTTGGTAATATTCGTCTCATCATTCATTATTTTCTTTGTTTCATATATATCATCCAATACTTGTAGTTTTACTCTAATATGTTTGTATGTTTGTGAATGA ATGGTTGGAAATACAGGTGATGAATCTGCATTCAGTTACAATGAGGGAAATGGAAATGGACCAAAAGAATGGGGAAAGCTAAAAGCAGATTGGAAATCTTGTGAGGAAGGGAAGTATCAGTCTCCCATTAATATTGTTGAAGAAGATGTTCAAGTTCTTCCTAAGCTTGGAAAACTTAGAAGGGATTACAATCCTGCTCCCGCTATCGTCAAGAATCGAGGACACGACATTTTGGTAATATTCGTCTCATCATTCATTATTTTCTTTGTTTCATATATATCATCCAATACTTGTAGTTTTACTCTAATATGTTTGTATGTTTGTGAATGA MVGNTGDESAFSYNEGNGNGPKEWGKLKADWKSCEEGKYQSPINIVEEDVQVLPKLGKLRRDYNPAPAIVKNRGHDILVIFVSSFIIFFVSYISSNTCSFTLICLYVCE*
BLAST of Cucsa.018130 vs. Swiss-Prot
Match: ATCA7_ARATH (Alpha carbonic anhydrase 7 OS=Arabidopsis thaliana GN=ACA7 PE=2 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 1.2e-17 Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 1
BLAST of Cucsa.018130 vs. Swiss-Prot
Match: ATCA2_ARATH (Alpha carbonic anhydrase 2 OS=Arabidopsis thaliana GN=ACA2 PE=2 SV=2) HSP 1 Score: 81.3 bits (199), Expect = 7.5e-15 Identity = 35/75 (46.67%), Postives = 51/75 (68.00%), Query Frame = 1
BLAST of Cucsa.018130 vs. Swiss-Prot
Match: NEC3_NICLS (Bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NEC3 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 9.8e-15 Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 1
BLAST of Cucsa.018130 vs. Swiss-Prot
Match: ATCA8_ARATH (Alpha carbonic anhydrase 8 OS=Arabidopsis thaliana GN=ACA8 PE=3 SV=3) HSP 1 Score: 80.5 bits (197), Expect = 1.3e-14 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
BLAST of Cucsa.018130 vs. Swiss-Prot
Match: ATCA5_ARATH (Alpha carbonic anhydrase 5 OS=Arabidopsis thaliana GN=ACA5 PE=3 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.8e-14 Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Cucsa.018130 vs. TrEMBL
Match: A0A0A0KYG6_CUCSA (Uncharacterized protein OS=Cucumis sativus GN=Csa_4G342570 PE=4 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 5.2e-39 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Cucsa.018130 vs. TrEMBL
Match: A0A061EXL7_THECC (Alpha carbonic anhydrase 4, putative OS=Theobroma cacao GN=TCM_024529 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 2.6e-22 Identity = 49/74 (66.22%), Postives = 58/74 (78.38%), Query Frame = 1
BLAST of Cucsa.018130 vs. TrEMBL
Match: A0A0D2RVW7_GOSRA (Uncharacterized protein OS=Gossypium raimondii GN=B456_006G135100 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 5.7e-22 Identity = 49/74 (66.22%), Postives = 59/74 (79.73%), Query Frame = 1
BLAST of Cucsa.018130 vs. TrEMBL
Match: B9T349_RICCO (Carbonic anhydrase, putative OS=Ricinus communis GN=RCOM_0142740 PE=4 SV=1) HSP 1 Score: 111.7 bits (278), Expect = 5.7e-22 Identity = 47/75 (62.67%), Postives = 57/75 (76.00%), Query Frame = 1
BLAST of Cucsa.018130 vs. TrEMBL
Match: A0A059A4M0_EUCGR (Uncharacterized protein OS=Eucalyptus grandis GN=EUGRSUZ_K02021 PE=4 SV=1) HSP 1 Score: 111.3 bits (277), Expect = 7.5e-22 Identity = 47/76 (61.84%), Postives = 61/76 (80.26%), Query Frame = 1
BLAST of Cucsa.018130 vs. TAIR10
Match: AT1G08080.1 (AT1G08080.1 alpha carbonic anhydrase 7) HSP 1 Score: 90.5 bits (223), Expect = 6.9e-19 Identity = 37/79 (46.84%), Postives = 56/79 (70.89%), Query Frame = 1
BLAST of Cucsa.018130 vs. TAIR10
Match: AT2G28210.1 (AT2G28210.1 alpha carbonic anhydrase 2) HSP 1 Score: 81.3 bits (199), Expect = 4.2e-16 Identity = 35/75 (46.67%), Postives = 51/75 (68.00%), Query Frame = 1
BLAST of Cucsa.018130 vs. TAIR10
Match: AT5G56330.1 (AT5G56330.1 alpha carbonic anhydrase 8) HSP 1 Score: 80.5 bits (197), Expect = 7.2e-16 Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
BLAST of Cucsa.018130 vs. TAIR10
Match: AT1G08065.1 (AT1G08065.1 alpha carbonic anhydrase 5) HSP 1 Score: 78.6 bits (192), Expect = 2.7e-15 Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 1
BLAST of Cucsa.018130 vs. TAIR10
Match: AT4G20990.1 (AT4G20990.1 alpha carbonic anhydrase 4) HSP 1 Score: 76.6 bits (187), Expect = 1.0e-14 Identity = 33/73 (45.21%), Postives = 46/73 (63.01%), Query Frame = 1
BLAST of Cucsa.018130 vs. NCBI nr
Match: gi|700199350|gb|KGN54508.1| (hypothetical protein Csa_4G342570 [Cucumis sativus]) HSP 1 Score: 168.3 bits (425), Expect = 7.4e-39 Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 1
BLAST of Cucsa.018130 vs. NCBI nr
Match: gi|778694185|ref|XP_011653762.1| (PREDICTED: alpha carbonic anhydrase 4-like [Cucumis sativus]) HSP 1 Score: 159.5 bits (402), Expect = 3.4e-36 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 1
BLAST of Cucsa.018130 vs. NCBI nr
Match: gi|659129264|ref|XP_008464600.1| (PREDICTED: LOW QUALITY PROTEIN: bifunctional monodehydroascorbate reductase and carbonic anhydrase nectarin-3-like [Cucumis melo]) HSP 1 Score: 144.4 bits (363), Expect = 1.1e-31 Identity = 65/74 (87.84%), Postives = 69/74 (93.24%), Query Frame = 1
BLAST of Cucsa.018130 vs. NCBI nr
Match: gi|590635452|ref|XP_007028635.1| (Alpha carbonic anhydrase 4, putative [Theobroma cacao]) HSP 1 Score: 112.8 bits (281), Expect = 3.7e-22 Identity = 49/74 (66.22%), Postives = 58/74 (78.38%), Query Frame = 1
BLAST of Cucsa.018130 vs. NCBI nr
Match: gi|694371265|ref|XP_009363226.1| (PREDICTED: alpha carbonic anhydrase 4-like [Pyrus x bretschneideri]) HSP 1 Score: 112.1 bits (279), Expect = 6.3e-22 Identity = 47/72 (65.28%), Postives = 60/72 (83.33%), Query Frame = 1
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber (Gy14)
Date Performed: 2017-01-17
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |