CsaV3_UNG164240 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTGTCTCCTTAGCAAGCCCAGACGGACGAGTTGTTGGTGGTGGAGTTGCTGGTTTGTTAGTAGCTGCAAGTCCAGTTCAAGTATGTGCCTTCTCCTTTCACTACCCGTAATTTTAAAACGAAACAAAATTTTGTTGTTTGAGCTTATATTTCTTCTTTTATTACTACTTTCGAAAATGATAGGTGGTTGTAGGAAGCTTTATATCTGGTAACCAACATGAGCAAAAGCCGAAGAAGCCAAAACACGATGTTGTATTACCGGTTTCTACATTTCCAATCTCTAGTGTTGAACCAAAATCATACAAGACGACGACAACTATGACAACATCTTCGTTTCGTGCGGAAACATGGTCACCTAATGTAGTTCCAGATTTAAGAAGTCAACCAACTGATATCAATGTATCATTAACTAGTGGTTGA ATGAGTGTCTCCTTAGCAAGCCCAGACGGACGAGTTGTTGGTGGTGGAGTTGCTGGTTTGTTAGTAGCTGCAAGTCCAGTTCAAGTGGTTGTAGGAAGCTTTATATCTGGTAACCAACATGAGCAAAAGCCGAAGAAGCCAAAACACGATGTTGTATTACCGGTTTCTACATTTCCAATCTCTAGTGTTGAACCAAAATCATACAAGACGACGACAACTATGACAACATCTTCGTTTCGTGCGGAAACATGGTCACCTAATGTAGTTCCAGATTTAAGAAGTCAACCAACTGATATCAATGTATCATTAACTAGTGGTTGA ATGAGTGTCTCCTTAGCAAGCCCAGACGGACGAGTTGTTGGTGGTGGAGTTGCTGGTTTGTTAGTAGCTGCAAGTCCAGTTCAAGTGGTTGTAGGAAGCTTTATATCTGGTAACCAACATGAGCAAAAGCCGAAGAAGCCAAAACACGATGTTGTATTACCGGTTTCTACATTTCCAATCTCTAGTGTTGAACCAAAATCATACAAGACGACGACAACTATGACAACATCTTCGTTTCGTGCGGAAACATGGTCACCTAATGTAGTTCCAGATTTAAGAAGTCAACCAACTGATATCAATGTATCATTAACTAGTGGTTGA MSVSLASPDGRVVGGGVAGLLVAASPVQVVVGSFISGNQHEQKPKKPKHDVVLPVSTFPISSVEPKSYKTTTTMTTSSFRAETWSPNVVPDLRSQPTDINVSLTSG
BLAST of CsaV3_UNG164240 vs. NCBI nr
Match: XP_004149134.2 (PREDICTED: AT-hook motif nuclear-localized protein 1-like [Cucumis sativus] >KGN49574.1 hypothetical protein Csa_5G010650 [Cucumis sativus]) HSP 1 Score: 203.4 bits (516), Expect = 3.9e-49 Identity = 105/106 (99.06%), Postives = 105/106 (99.06%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. NCBI nr
Match: XP_008460609.1 (PREDICTED: AT-hook motif nuclear-localized protein 1-like isoform X1 [Cucumis melo]) HSP 1 Score: 187.6 bits (475), Expect = 2.2e-44 Identity = 100/106 (94.34%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. NCBI nr
Match: XP_008460610.1 (PREDICTED: AT-hook motif nuclear-localized protein 1-like isoform X2 [Cucumis melo]) HSP 1 Score: 187.6 bits (475), Expect = 2.2e-44 Identity = 100/106 (94.34%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. NCBI nr
Match: XP_022923290.1 (AT-hook motif nuclear-localized protein 1-like [Cucurbita moschata]) HSP 1 Score: 154.5 bits (389), Expect = 2.1e-34 Identity = 84/108 (77.78%), Postives = 89/108 (82.41%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. NCBI nr
Match: XP_023553233.1 (AT-hook motif nuclear-localized protein 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 153.3 bits (386), Expect = 4.7e-34 Identity = 85/108 (78.70%), Postives = 89/108 (82.41%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TAIR10
Match: AT4G12080.1 (AT-hook motif nuclear-localized protein 1) HSP 1 Score: 104.4 bits (259), Expect = 4.5e-23 Identity = 60/107 (56.07%), Postives = 78/107 (72.90%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TAIR10
Match: AT4G22770.1 (AT hook motif DNA-binding family protein) HSP 1 Score: 85.1 bits (209), Expect = 2.8e-17 Identity = 55/106 (51.89%), Postives = 70/106 (66.04%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TAIR10
Match: AT4G00200.1 (AT hook motif DNA-binding family protein) HSP 1 Score: 68.9 bits (167), Expect = 2.1e-12 Identity = 35/46 (76.09%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TAIR10
Match: AT5G62260.1 (AT hook motif DNA-binding family protein) HSP 1 Score: 59.7 bits (143), Expect = 1.3e-09 Identity = 29/46 (63.04%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TAIR10
Match: AT2G33620.1 (AT hook motif DNA-binding family protein) HSP 1 Score: 58.5 bits (140), Expect = 2.8e-09 Identity = 39/78 (50.00%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. Swiss-Prot
Match: sp|Q8VYJ2|AHL1_ARATH (AT-hook motif nuclear-localized protein 1 OS=Arabidopsis thaliana OX=3702 GN=AHL1 PE=1 SV=1) HSP 1 Score: 104.4 bits (259), Expect = 8.1e-22 Identity = 60/107 (56.07%), Postives = 78/107 (72.90%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. Swiss-Prot
Match: sp|O49658|AHL2_ARATH (AT-hook motif nuclear-localized protein 2 OS=Arabidopsis thaliana OX=3702 GN=AHL2 PE=2 SV=1) HSP 1 Score: 85.1 bits (209), Expect = 5.1e-16 Identity = 55/106 (51.89%), Postives = 70/106 (66.04%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. Swiss-Prot
Match: sp|Q4V3E0|AHL7_ARATH (AT-hook motif nuclear-localized protein 7 OS=Arabidopsis thaliana OX=3702 GN=AHL7 PE=2 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.8e-11 Identity = 35/46 (76.09%), Postives = 42/46 (91.30%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. Swiss-Prot
Match: sp|Q9LVB0|AHL6_ARATH (AT-hook motif nuclear-localized protein 6 OS=Arabidopsis thaliana OX=3702 GN=AHL6 PE=2 SV=1) HSP 1 Score: 59.7 bits (143), Expect = 2.3e-08 Identity = 29/46 (63.04%), Postives = 37/46 (80.43%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. Swiss-Prot
Match: sp|O22812|AHL10_ARATH (AT-hook motif nuclear-localized protein 10 OS=Arabidopsis thaliana OX=3702 GN=AHL10 PE=1 SV=2) HSP 1 Score: 58.5 bits (140), Expect = 5.1e-08 Identity = 39/78 (50.00%), Postives = 50/78 (64.10%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TrEMBL
Match: tr|A0A0A0KL67|A0A0A0KL67_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G010650 PE=4 SV=1) HSP 1 Score: 203.4 bits (516), Expect = 2.6e-49 Identity = 105/106 (99.06%), Postives = 105/106 (99.06%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TrEMBL
Match: tr|A0A1S3CCX9|A0A1S3CCX9_CUCME (AT-hook motif nuclear-localized protein 1-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103499388 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 1.5e-44 Identity = 100/106 (94.34%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TrEMBL
Match: tr|A0A1S3CCU9|A0A1S3CCU9_CUCME (AT-hook motif nuclear-localized protein 1-like isoform X2 OS=Cucumis melo OX=3656 GN=LOC103499388 PE=4 SV=1) HSP 1 Score: 187.6 bits (475), Expect = 1.5e-44 Identity = 100/106 (94.34%), Postives = 102/106 (96.23%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TrEMBL
Match: tr|A0A2P4KGG5|A0A2P4KGG5_QUESU (At-hook motif nuclear-localized protein 1 OS=Quercus suber OX=58331 GN=CFP56_29668 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 1.6e-27 Identity = 73/109 (66.97%), Postives = 83/109 (76.15%), Query Frame = 0
BLAST of CsaV3_UNG164240 vs. TrEMBL
Match: tr|A0A061GBU0|A0A061GBU0_THECC (AT-hook motif nuclear-localized protein 1 isoform 2 OS=Theobroma cacao OX=3641 GN=TCM_016097 PE=4 SV=1) HSP 1 Score: 131.0 bits (328), Expect = 1.6e-27 Identity = 71/109 (65.14%), Postives = 88/109 (80.73%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|