CsaV3_7G020970 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGATTGCAATGCCACAAAATACCCGATGGAACCCAAGGCACAACTTCACAAAGACACGGAAGAAGCACCAATTGATGCTACGGAGTACAGAAGCATCGTCGTTGTTGTCTTAGACTACTTACTGAACACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG ATGGCTGATTGCAATGCCACAAAATACCCGATGGAACCCAAGGCACAACTTCACAAAGACACGGAAGAAGCACCAATTGATGCTACGGAGTACAGAAGCATCGTCGTTGTTGTCTTAGACTACTTACTGAACACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG ATGGCTGATTGCAATGCCACAAAATACCCGATGGAACCCAAGGCACAACTTCACAAAGACACGGAAGAAGCACCAATTGATGCTACGGAGTACAGAAGCATCGTCGTTGTTGTCTTAGACTACTTACTGAACACAAGGCCAGATCTTTCATATGTTGTTGGGATGGCGAGTAGGTATATGGAAAGGCCTACAACCATGCATTACAAGGTGGTCAAGCAAATACTTAG MADCNATKYPMEPKAQLHKDTEEAPIDATEYRSIVVVVLDYLLNTRPDLSYVVGMASRYMERPTTMHYKVVKQILX
BLAST of CsaV3_7G020970 vs. NCBI nr
Match: BAF22809.1 (Os08g0125300 [Oryza sativa Japonica Group] >BAG92574.1 unnamed protein product [Oryza sativa Japonica Group] >BAT03649.1 Os08g0125300 [Oryza sativa Japonica Group]) HSP 1 Score: 99.4 bits (246), Expect = 5.7e-18 Identity = 50/75 (66.67%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. NCBI nr
Match: EEC84282.1 (hypothetical protein OsI_30754 [Oryza sativa Indica Group]) HSP 1 Score: 99.4 bits (246), Expect = 5.7e-18 Identity = 50/75 (66.67%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. NCBI nr
Match: ABF94034.1 (retrotransposon protein, putative, unclassified [Oryza sativa Japonica Group]) HSP 1 Score: 97.8 bits (242), Expect = 1.7e-17 Identity = 47/75 (62.67%), Postives = 59/75 (78.67%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. NCBI nr
Match: XP_020249213.1 (uncharacterized protein LOC109826599 [Asparagus officinalis]) HSP 1 Score: 96.7 bits (239), Expect = 3.7e-17 Identity = 48/75 (64.00%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. NCBI nr
Match: CAE04421.2 (OSJNBb0040D15.11 [Oryza sativa Japonica Group]) HSP 1 Score: 95.9 bits (237), Expect = 6.3e-17 Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. TAIR10
Match: ATMG00810.1 (DNA/RNA polymerases superfamily protein) HSP 1 Score: 46.6 bits (109), Expect = 7.9e-06 Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. Swiss-Prot
Match: sp|Q9ZT94|POLR2_ARATH (Retrovirus-related Pol polyprotein from transposon RE2 OS=Arabidopsis thaliana OX=3702 GN=RE2 PE=4 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 6.9e-07 Identity = 33/70 (47.14%), Postives = 39/70 (55.71%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. Swiss-Prot
Match: sp|Q94HW2|POLR1_ARATH (Retrovirus-related Pol polyprotein from transposon RE1 OS=Arabidopsis thaliana OX=3702 GN=RE1 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 1.7e-05 Identity = 29/66 (43.94%), Postives = 37/66 (56.06%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. Swiss-Prot
Match: sp|P92519|M810_ARATH (Uncharacterized mitochondrial protein AtMg00810 OS=Arabidopsis thaliana OX=3702 GN=AtMg00810 PE=4 SV=1) HSP 1 Score: 46.6 bits (109), Expect = 1.4e-04 Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. TrEMBL
Match: tr|A0A0A9FJ50|A0A0A9FJ50_ARUDO (Uncharacterized protein OS=Arundo donax OX=35708 PE=4 SV=1) HSP 1 Score: 100.9 bits (250), Expect = 1.3e-18 Identity = 51/75 (68.00%), Postives = 61/75 (81.33%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. TrEMBL
Match: tr|Q0J8A6|Q0J8A6_ORYSJ (Os08g0125300 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0125300 PE=2 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.8e-18 Identity = 50/75 (66.67%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. TrEMBL
Match: tr|B8BDZ6|B8BDZ6_ORYSI (Uncharacterized protein OS=Oryza sativa subsp. indica OX=39946 GN=OsI_30754 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 3.8e-18 Identity = 50/75 (66.67%), Postives = 57/75 (76.00%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. TrEMBL
Match: tr|Q10RM4|Q10RM4_ORYSJ (Retrotransposon protein, putative, unclassified OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os03g05850 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.1e-17 Identity = 47/75 (62.67%), Postives = 59/75 (78.67%), Query Frame = 0
BLAST of CsaV3_7G020970 vs. TrEMBL
Match: tr|Q7XMW3|Q7XMW3_ORYSJ (OSJNBb0040D15.11 protein OS=Oryza sativa subsp. japonica OX=39947 GN=OSJNBb0040D15.11 PE=4 SV=2) HSP 1 Score: 95.9 bits (237), Expect = 4.2e-17 Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |