CsaV3_7G013800 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCTCATGTAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGGTGGAACCAATTGGCGTCTGGAGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGGAATGGGAGAATTTCAAGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGA ATGTCTTCTCATGTAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGGTGGAACCAATTGGCGTCTGGAGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGGAATGGGAGAATTTCAAGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGA ATGTCTTCTCATGTAATTGTTGGAGATTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACCTAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGGTGGAACCAATTGGCGTCTGGAGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGGAATGGGAGAATTTCAAGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGA MSSHVIVGDYRPCENSDGPHAKEVAQWAVTEYNLKHRHERPYLYLLSVLKCESQVVGGTNWRLELKCKDENNIEVNCEAVVWEKEWENFKELTSFIVFYPSSG
BLAST of CsaV3_7G013800 vs. NCBI nr
Match: KGN48304.1 (hypothetical protein Csa_6G459990 [Cucumis sativus]) HSP 1 Score: 206.1 bits (523), Expect = 5.9e-50 Identity = 93/103 (90.29%), Postives = 96/103 (93.20%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. NCBI nr
Match: KGN48305.1 (hypothetical protein Csa_6G460000 [Cucumis sativus]) HSP 1 Score: 199.5 bits (506), Expect = 5.5e-48 Identity = 91/103 (88.35%), Postives = 93/103 (90.29%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. NCBI nr
Match: NP_001267677.1 (cysteine proteinase inhibitor 5-like [Cucumis sativus] >BAA28867.1 cystein proteinase inhibitor [Cucumis sativus]) HSP 1 Score: 119.4 bits (298), Expect = 7.3e-24 Identity = 53/89 (59.55%), Postives = 66/89 (74.16%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. NCBI nr
Match: XP_008441065.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis melo]) HSP 1 Score: 95.5 bits (236), Expect = 1.1e-16 Identity = 45/88 (51.14%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. NCBI nr
Match: XP_009396391.1 (PREDICTED: cysteine proteinase inhibitor 1-like [Musa acuminata subsp. malaccensis]) HSP 1 Score: 93.2 bits (230), Expect = 5.6e-16 Identity = 45/94 (47.87%), Postives = 63/94 (67.02%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 70.5 bits (171), Expect = 7.0e-13 Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 54.7 bits (130), Expect = 4.0e-08 Identity = 31/89 (34.83%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TAIR10
Match: AT5G05110.1 (Cystatin/monellin family protein) HSP 1 Score: 52.8 bits (125), Expect = 1.5e-07 Identity = 33/84 (39.29%), Postives = 43/84 (51.19%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 51.6 bits (122), Expect = 3.4e-07 Identity = 27/81 (33.33%), Postives = 44/81 (54.32%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 49.3 bits (116), Expect = 1.7e-06 Identity = 34/89 (38.20%), Postives = 46/89 (51.69%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 2.6e-12 Identity = 39/91 (42.86%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 70.5 bits (171), Expect = 1.3e-11 Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 1.1e-07 Identity = 32/87 (36.78%), Postives = 49/87 (56.32%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. Swiss-Prot
Match: sp|P09229|CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 55.5 bits (132), Expect = 4.2e-07 Identity = 33/90 (36.67%), Postives = 50/90 (55.56%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. Swiss-Prot
Match: sp|P31726|CYT1_MAIZE (Cystatin-1 OS=Zea mays OX=4577 GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 5.5e-07 Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TrEMBL
Match: tr|A0A0A0KHK7|A0A0A0KHK7_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G459990 PE=3 SV=1) HSP 1 Score: 206.1 bits (523), Expect = 3.9e-50 Identity = 93/103 (90.29%), Postives = 96/103 (93.20%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TrEMBL
Match: tr|A0A0A0KF17|A0A0A0KF17_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G460000 PE=3 SV=1) HSP 1 Score: 199.5 bits (506), Expect = 3.7e-48 Identity = 91/103 (88.35%), Postives = 93/103 (90.29%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TrEMBL
Match: tr|O80389|O80389_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 119.4 bits (298), Expect = 4.8e-24 Identity = 53/89 (59.55%), Postives = 66/89 (74.16%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TrEMBL
Match: tr|A0A1S3B2L7|A0A1S3B2L7_CUCME (Cysteine proteinase inhibitor OS=Cucumis melo OX=3656 GN=LOC103485290 PE=3 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 7.4e-17 Identity = 45/88 (51.14%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of CsaV3_7G013800 vs. TrEMBL
Match: tr|M0SNR0|M0SNR0_MUSAM (Cysteine proteinase inhibitor OS=Musa acuminata subsp. malaccensis OX=214687 GN=103981394 PE=3 SV=1) HSP 1 Score: 93.2 bits (230), Expect = 3.7e-16 Identity = 45/94 (47.87%), Postives = 63/94 (67.02%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|