CsaV3_7G013780 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CTTAATTACCTTTTAGAAGTAGAGTATTAGATTCCACAAATTAAAGAATTAATAATAAATTAAGTCGAAGGAAAAGAGTGGAATAAATTGGAGTAGTATAAATTTGAAACCCCCTTGTTTACAAAGAAATCACGAATTAAAAATTCCATAAGAGCTTTGTCTGGATTGAAAGAAAGTAAGGTAGGAAAATGTCTTCTCATGTAACTCTTGGAGCTTATGGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCAGGGAGCTCAAATCCTTCATAGTATTCTACCCATCTTCTGGTTGA ATGTCTTCTCATGTAACTCTTGGAGCTTATGGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCAGGGAGCTCAAATCCTTCATAGTATTCTACCCATCTTCTGGTTGA ATGTCTTCTCATGTAACTCTTGGAGCTTATGGACCATGTGAGAATTCAGATGGTGAACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAGATGGGAGAATTTCAGGGAGCTCAAATCCTTCATAGTATTCTACCCATCTTCTGGTTGA MSSHVTLGAYGPCENSDGEHAKEVAQWAVTEYNIKHRHERPYLYLLSVLKCESQVVAGTNWRLGLKCKDENNIEVNCEAVVWEKRWENFRELKSFIVFYPSSG
BLAST of CsaV3_7G013780 vs. NCBI nr
Match: KGN48304.1 (hypothetical protein Csa_6G459990 [Cucumis sativus]) HSP 1 Score: 223.4 bits (568), Expect = 3.6e-55 Identity = 102/103 (99.03%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. NCBI nr
Match: KGN48305.1 (hypothetical protein Csa_6G460000 [Cucumis sativus]) HSP 1 Score: 208.4 bits (529), Expect = 1.2e-50 Identity = 95/103 (92.23%), Postives = 96/103 (93.20%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. NCBI nr
Match: NP_001267677.1 (cysteine proteinase inhibitor 5-like [Cucumis sativus] >BAA28867.1 cystein proteinase inhibitor [Cucumis sativus]) HSP 1 Score: 117.5 bits (293), Expect = 2.8e-23 Identity = 54/89 (60.67%), Postives = 66/89 (74.16%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. NCBI nr
Match: KGN48334.1 (hypothetical protein Csa_6G482230 [Cucumis sativus]) HSP 1 Score: 96.7 bits (239), Expect = 5.0e-17 Identity = 50/85 (58.82%), Postives = 59/85 (69.41%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. NCBI nr
Match: XP_009396391.1 (PREDICTED: cysteine proteinase inhibitor 1-like [Musa acuminata subsp. malaccensis]) HSP 1 Score: 90.9 bits (224), Expect = 2.8e-15 Identity = 46/94 (48.94%), Postives = 62/94 (65.96%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 65.1 bits (157), Expect = 3.0e-11 Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TAIR10
Match: AT5G05110.1 (Cystatin/monellin family protein) HSP 1 Score: 56.2 bits (134), Expect = 1.4e-08 Identity = 36/97 (37.11%), Postives = 52/97 (53.61%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 52.4 bits (124), Expect = 2.0e-07 Identity = 27/81 (33.33%), Postives = 46/81 (56.79%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 50.4 bits (119), Expect = 7.5e-07 Identity = 30/89 (33.71%), Postives = 48/89 (53.93%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TAIR10
Match: AT3G12490.2 (cystatin B) HSP 1 Score: 49.7 bits (117), Expect = 1.3e-06 Identity = 32/84 (38.10%), Postives = 46/84 (54.76%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.8e-11 Identity = 39/91 (42.86%), Postives = 56/91 (61.54%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 65.1 bits (157), Expect = 5.3e-10 Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. Swiss-Prot
Match: sp|Q8LC76|CYT7_ARATH (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana OX=3702 GN=CYS7 PE=2 SV=2) HSP 1 Score: 56.2 bits (134), Expect = 2.5e-07 Identity = 36/97 (37.11%), Postives = 52/97 (53.61%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. Swiss-Prot
Match: sp|P31726|CYT1_MAIZE (Cystatin-1 OS=Zea mays OX=4577 GN=RAMDAZC7 PE=2 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 4.2e-07 Identity = 31/81 (38.27%), Postives = 49/81 (60.49%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. Swiss-Prot
Match: sp|P09229|CYT1_ORYSJ (Cysteine proteinase inhibitor 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0803200 PE=1 SV=2) HSP 1 Score: 54.7 bits (130), Expect = 7.2e-07 Identity = 34/89 (38.20%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TrEMBL
Match: tr|A0A0A0KHK7|A0A0A0KHK7_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G459990 PE=3 SV=1) HSP 1 Score: 223.4 bits (568), Expect = 2.4e-55 Identity = 102/103 (99.03%), Postives = 102/103 (99.03%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TrEMBL
Match: tr|A0A0A0KF17|A0A0A0KF17_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G460000 PE=3 SV=1) HSP 1 Score: 208.4 bits (529), Expect = 7.9e-51 Identity = 95/103 (92.23%), Postives = 96/103 (93.20%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TrEMBL
Match: tr|O80389|O80389_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 117.5 bits (293), Expect = 1.8e-23 Identity = 54/89 (60.67%), Postives = 66/89 (74.16%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TrEMBL
Match: tr|A0A0A0KHN6|A0A0A0KHN6_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G482230 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 3.3e-17 Identity = 50/85 (58.82%), Postives = 59/85 (69.41%), Query Frame = 0
BLAST of CsaV3_7G013780 vs. TrEMBL
Match: tr|M0SNR0|M0SNR0_MUSAM (Cysteine proteinase inhibitor OS=Musa acuminata subsp. malaccensis OX=214687 GN=103981394 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 1.8e-15 Identity = 46/94 (48.94%), Postives = 62/94 (65.96%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|