CsaV3_6G032160 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAAAAGGTAAGATCTATAGTTTTCTAATTTGGAGATTGTGGAGGAACTTATTGTAATTTTGAAGTATTTTGATAACGTGAACTACATCTCTTGTTTGTGAGTTTTAGTTTGGATACATTTAAATATTGATCGGCTTCCCATGCTTAGACCGCATAGTTTGATGGTTTAGGTTAACATATATAATACATGGCATATAGTTATAGGTTAGTCTCTAAGAAAAGCGATAGACCACCTTTTGATTCAAAGGGAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCAATCCTTAAAAAACGAAATCGTTGAGTGAGAAATGGAAAATTCATGGAAAGTTACAATCCCCACCGCGTAATAGTGCACCCACACGTCTTCATCGATGTTTTTTAACCGGAAGACCGAGAGCAAACTATCAAGACCTTGGGTTCTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCTTGGGATGACAATGAAGAATATTATTCTATTGTTCTAA ATGGAAAAAGCGATAGACCACCTTTTGATTCAAAGGGAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCAATCCTTAAAAAACGAAATCGTTGATGCACCCACACGTCTTCATCGATGTTTTTTAACCGGAAGACCGAGAGCAAACTATCAAGACCTTGGGTTCTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCTTGGGATGACAATGAAGAATATTATTCTATTGTTCTAA ATGGAAAAAGCGATAGACCACCTTTTGATTCAAAGGGAGAAGAGGCAAAAATTGGAACAAAAATATCATTTGATTCGTCAATCCTTAAAAAACGAAATCGTTGATGCACCCACACGTCTTCATCGATGTTTTTTAACCGGAAGACCGAGAGCAAACTATCAAGACCTTGGGTTCTCTGGACACATACTTCGTGAAATGGTTCATGCATGCTTGTTGCTTGGGATGACAATGAAGAATATTATTCTATTGTTCTAA MEKAIDHLLIQREKRQKLEQKYHLIRQSLKNEIVDAPTRLHRCFLTGRPRANYQDLGFSGHILREMVHACLLLGMTMKNIILLF
BLAST of CsaV3_6G032160 vs. NCBI nr
Match: KGN47606.1 (hypothetical protein Csa_6G364110 [Cucumis sativus]) HSP 1 Score: 168.7 bits (426), Expect = 8.5e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. NCBI nr
Match: YP_247597.1 (ribosomal protein S14 [Cucumis sativus] >YP_009004042.1 ribosomal protein S14 [Cucumis hystrix] >YP_009346483.1 ribosomal protein S14 (chloroplast) [Cucumis x hytivus] >Q4VZN5.1 RecName: Full=30S ribosomal protein S14, chloroplastic >AAO38177.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >CAJ00756.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >AAZ94649.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >ABI97415.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >ABI98744.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >AHJ61384.1 ribosomal protein S14 (plastid) [Cucumis hystrix] >ALF03299.1 ribosomal protein S14 (chloroplast) [Cucumis sativus var. hardwickii] >ANF28375.1 ribosomal protein S14 (chloroplast) [Cucumis sativus var. hardwickii] >AOW71093.1 ribosomal protein S14 (chloroplast) [Cucumis x hytivus] >ARQ16076.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >ARQ16159.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >ARQ16242.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >ARQ16325.1 ribosomal protein S14 (chloroplast) [Cucumis sativus] >ASY97504.1 ribosomal protein S14 (chloroplast) [Cucumis sativus var. hardwickii] >AVE15329.1 ribosomal protein S14 (chloroplast) [Cucumis sativus var. sativus]) HSP 1 Score: 103.6 bits (257), Expect = 3.4e-19 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. NCBI nr
Match: AEX65502.1 (30S ribosomal protein S14, partial (chloroplast) [Anredera baselloides]) HSP 1 Score: 99.8 bits (247), Expect = 4.9e-18 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. NCBI nr
Match: YP_009441438.1 (ribosomal protein S14 (chloroplast) [Portulaca oleracea] >YP_009485792.1 ribosomal protein S14 (chloroplast) [Talinum paniculatum] >AEX65504.1 30S ribosomal protein S14, partial (chloroplast) [Didierea madagascariensis] >AEX65510.1 30S ribosomal protein S14, partial (chloroplast) [Portulaca oleracea] >ATN40580.1 ribosomal protein S14 (chloroplast) [Portulaca oleracea] >AVZ66361.1 ribosomal protein S14 (chloroplast) [Talinum paniculatum]) HSP 1 Score: 99.8 bits (247), Expect = 4.9e-18 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. NCBI nr
Match: YP_009317384.1 (ribosomal protein S14 (chloroplast) [Coccinia grandis] >YP_009325987.1 ribosomal protein S14 (chloroplast) [Citrullus lanatus] >YP_009348029.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >YP_009420792.1 ribosomal protein S14 (chloroplast) [Citrullus colocynthis] >YP_009431555.1 ribosomal protein S14 (chloroplast) [Citrullus amarus] >YP_009431640.1 ribosomal protein S14 (chloroplast) [Citrullus rehmii] >YP_009456144.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89066.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89125.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89184.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89362.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89480.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89599.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89658.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89717.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89776.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89835.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89894.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM89953.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90071.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90130.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90189.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90366.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90484.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90543.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90602.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90720.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90779.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90838.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90897.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AHM90956.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AOX48768.1 ribosomal protein S14 (chloroplast) [Coccinia grandis] >AOX48853.1 ribosomal protein S14 (chloroplast) [Coccinia grandis] >APD52478.1 ribosomal protein S14 (chloroplast) [Citrullus lanatus] >APW82459.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82544.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82629.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82714.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >APW82799.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >APW82884.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW82969.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83054.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83139.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83224.1 ribosomal protein S14 (plastid) [Citrullus lanatus subsp. vulgaris] >APW83309.1 ribosomal protein S14 (plastid) [Citrullus mucosospermus] >ASP44511.1 ribosomal protein S14 (chloroplast) [Citrullus colocynthis] >ASY96203.1 ribosomal protein S14 (chloroplast) [Citrullus amarus] >ASY96292.1 ribosomal protein S14 (chloroplast) [Citrullus rehmii] >AUJ21910.1 ribosomal protein S14 (chloroplast) [Lagenaria siceraria] >AXR94574.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa] >AXR94660.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa] >AXR94743.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa] >AXR94829.1 ribosomal protein S14 (chloroplast) [Hodgsonia macrocarpa]) HSP 1 Score: 99.8 bits (247), Expect = 4.9e-18 Identity = 59/91 (64.84%), Postives = 61/91 (67.03%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. TAIR10
Match: ATCG00330.1 (chloroplast ribosomal protein S14) HSP 1 Score: 89.0 bits (219), Expect = 1.6e-18 Identity = 51/91 (56.04%), Postives = 57/91 (62.64%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. Swiss-Prot
Match: sp|Q4VZN5|RR14_CUCSA (30S ribosomal protein S14, chloroplastic OS=Cucumis sativus OX=3659 GN=rps14 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 1.1e-21 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. Swiss-Prot
Match: sp|B2XWK3|RR14_FAGEA (30S ribosomal protein S14, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale OX=180217 GN=rps14 PE=3 SV=1) HSP 1 Score: 96.7 bits (239), Expect = 1.3e-19 Identity = 57/91 (62.64%), Postives = 60/91 (65.93%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. Swiss-Prot
Match: sp|Q8S8X6|RR14_ATRBE (30S ribosomal protein S14, chloroplastic OS=Atropa belladonna OX=33113 GN=rps14 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.9e-19 Identity = 57/91 (62.64%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. Swiss-Prot
Match: sp|Q09MI0|RR14_CITSI (30S ribosomal protein S14, chloroplastic OS=Citrus sinensis OX=2711 GN=rps14 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.9e-19 Identity = 57/91 (62.64%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. Swiss-Prot
Match: sp|Q49L00|RR14_EUCGG (30S ribosomal protein S14, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rps14 PE=3 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 3.9e-19 Identity = 57/91 (62.64%), Postives = 59/91 (64.84%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. TrEMBL
Match: tr|A0A0A0KIM2|A0A0A0KIM2_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G364110 PE=4 SV=1) HSP 1 Score: 168.7 bits (426), Expect = 5.7e-39 Identity = 84/84 (100.00%), Postives = 84/84 (100.00%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. TrEMBL
Match: tr|A0A218KG37|A0A218KG37_CUCSA (30S ribosomal protein S14, chloroplastic OS=Cucumis sativus var. hardwickii OX=319220 GN=rps14 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.2e-19 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. TrEMBL
Match: tr|A0A1X9Q1T3|A0A1X9Q1T3_CUCSA (30S ribosomal protein S14, chloroplastic OS=Cucumis sativus OX=3659 GN=rps14 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.2e-19 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. TrEMBL
Match: tr|A0A1P8C7R9|A0A1P8C7R9_9ROSI (30S ribosomal protein S14, chloroplastic OS=Cucumis x hytivus OX=442738 GN=46791 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.2e-19 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 0
BLAST of CsaV3_6G032160 vs. TrEMBL
Match: tr|W8E1Z5|W8E1Z5_9ROSI (Ribosomal protein S14 OS=Cucumis hystrix OX=396994 GN=rps14 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 2.2e-19 Identity = 61/91 (67.03%), Postives = 62/91 (68.13%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |