CsaV3_6G022430 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAATGAACCATTCATCAAACTATCTCTACAACCTCGACATCAATGAAAACGGTCCCAAGTTGCGAGACGCATTGTCAAATGTTAGGTTTAGAGGGTTAGCTAGTGAGTTTGGTCTCGTCAATGGCCAATTACAATCATTCGTTTTCGAGATAGTGAACGTGGTCGGTAACGAAAGAAGGAGTGTGGGGTTTTGGACGCCGAAAGCTGGGCTGACAACAAGTCTACGACACTCGGGGAGAAAAAGGGAATTGAGACCGATCATATAG ATGAAAATGAACCATTCATCAAACTATCTCTACAACCTCGACATCAATGAAAACGGTCCCAAGTTGCGAGACGCATTGTCAAATGTTAGGTTTAGAGGGTTAGCTAGTGAGTTTGGTCTCGTCAATGGCCAATTACAATCATTCGTTTTCGAGATAGTGAACGTGGTCGGTAACGAAAGAAGGAGTGTGGGGTTTTGGACGCCGAAAGCTGGGCTGACAACAAGTCTACGACACTCGGGGAGAAAAAGGGAATTGAGACCGATCATATAG ATGAAAATGAACCATTCATCAAACTATCTCTACAACCTCGACATCAATGAAAACGGTCCCAAGTTGCGAGACGCATTGTCAAATGTTAGGTTTAGAGGGTTAGCTAGTGAGTTTGGTCTCGTCAATGGCCAATTACAATCATTCGTTTTCGAGATAGTGAACGTGGTCGGTAACGAAAGAAGGAGTGTGGGGTTTTGGACGCCGAAAGCTGGGCTGACAACAAGTCTACGACACTCGGGGAGAAAAAGGGAATTGAGACCGATCATATAG MKMNHSSNYLYNLDINENGPKLRDALSNVRFRGLASEFGLVNGQLQSFVFEIVNVVGNERRSVGFWTPKAGLTTSLRHSGRKRELRPII
BLAST of CsaV3_6G022430 vs. NCBI nr
Match: XP_011658435.1 (PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 2.5-like, partial [Cucumis sativus]) HSP 1 Score: 163.3 bits (412), Expect = 3.8e-37 Identity = 79/80 (98.75%), Postives = 80/80 (100.00%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. NCBI nr
Match: XP_016899964.1 (PREDICTED: glutamate receptor 2.5-like [Cucumis melo]) HSP 1 Score: 160.6 bits (405), Expect = 2.5e-36 Identity = 77/89 (86.52%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. NCBI nr
Match: XP_022951720.1 (glutamate receptor 2.5-like [Cucurbita moschata]) HSP 1 Score: 116.3 bits (290), Expect = 5.3e-23 Identity = 54/85 (63.53%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. NCBI nr
Match: XP_023002214.1 (glutamate receptor 2.2-like [Cucurbita maxima]) HSP 1 Score: 116.3 bits (290), Expect = 5.3e-23 Identity = 54/85 (63.53%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. NCBI nr
Match: XP_023537858.1 (glutamate receptor 2.2-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 116.3 bits (290), Expect = 5.3e-23 Identity = 54/85 (63.53%), Postives = 69/85 (81.18%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TAIR10
Match: AT2G29100.1 (glutamate receptor 2.9) HSP 1 Score: 84.3 bits (207), Expect = 4.1e-17 Identity = 42/80 (52.50%), Postives = 54/80 (67.50%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TAIR10
Match: AT2G29120.1 (glutamate receptor 2.7) HSP 1 Score: 77.4 bits (189), Expect = 5.0e-15 Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TAIR10
Match: AT5G11210.1 (glutamate receptor 2.5) HSP 1 Score: 74.7 bits (182), Expect = 3.2e-14 Identity = 41/85 (48.24%), Postives = 54/85 (63.53%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TAIR10
Match: AT2G29110.1 (glutamate receptor 2.8) HSP 1 Score: 74.3 bits (181), Expect = 4.2e-14 Identity = 35/63 (55.56%), Postives = 43/63 (68.25%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TAIR10
Match: AT2G24720.1 (glutamate receptor 2.2) HSP 1 Score: 72.4 bits (176), Expect = 1.6e-13 Identity = 35/72 (48.61%), Postives = 46/72 (63.89%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. Swiss-Prot
Match: sp|O81078|GLR29_ARATH (Glutamate receptor 2.9 OS=Arabidopsis thaliana OX=3702 GN=GLR2.9 PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.3e-16 Identity = 42/80 (52.50%), Postives = 54/80 (67.50%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. Swiss-Prot
Match: sp|Q8LGN0|GLR27_ARATH (Glutamate receptor 2.7 OS=Arabidopsis thaliana OX=3702 GN=GLR2.7 PE=2 SV=3) HSP 1 Score: 77.4 bits (189), Expect = 9.0e-14 Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. Swiss-Prot
Match: sp|Q9LFN5|GLR25_ARATH (Glutamate receptor 2.5 OS=Arabidopsis thaliana OX=3702 GN=GLR2.5 PE=2 SV=2) HSP 1 Score: 74.7 bits (182), Expect = 5.8e-13 Identity = 41/85 (48.24%), Postives = 54/85 (63.53%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. Swiss-Prot
Match: sp|Q9C5V5|GLR28_ARATH (Glutamate receptor 2.8 OS=Arabidopsis thaliana OX=3702 GN=GLR2.8 PE=2 SV=2) HSP 1 Score: 74.3 bits (181), Expect = 7.6e-13 Identity = 35/63 (55.56%), Postives = 43/63 (68.25%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. Swiss-Prot
Match: sp|Q9SHV1|GLR22_ARATH (Glutamate receptor 2.2 OS=Arabidopsis thaliana OX=3702 GN=GLR2.2 PE=2 SV=1) HSP 1 Score: 72.4 bits (176), Expect = 2.9e-12 Identity = 35/72 (48.61%), Postives = 46/72 (63.89%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TrEMBL
Match: tr|A0A1S4DVF3|A0A1S4DVF3_CUCME (Glutamate receptor OS=Cucumis melo OX=3656 GN=LOC103488568 PE=3 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 1.6e-36 Identity = 77/89 (86.52%), Postives = 83/89 (93.26%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TrEMBL
Match: tr|A0A0A0KG62|A0A0A0KG62_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G309940 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 3.9e-22 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TrEMBL
Match: tr|A0A1S3BCC4|A0A1S3BCC4_CUCME (Glutamate receptor OS=Cucumis melo OX=3656 GN=LOC103488370 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 8.1e-20 Identity = 54/89 (60.67%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TrEMBL
Match: tr|A0A1S4DVH3|A0A1S4DVH3_CUCME (glutamate receptor 2.2-like isoform X3 OS=Cucumis melo OX=3656 GN=LOC103488370 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 8.1e-20 Identity = 54/89 (60.67%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of CsaV3_6G022430 vs. TrEMBL
Match: tr|A0A1S3BD80|A0A1S3BD80_CUCME (Glutamate receptor OS=Cucumis melo OX=3656 GN=LOC103488370 PE=3 SV=1) HSP 1 Score: 105.1 bits (261), Expect = 8.1e-20 Identity = 54/89 (60.67%), Postives = 68/89 (76.40%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |