CsaV3_6G017250 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTACTTTATTCTAGAAATGAATGTCATTTGTGTGGAAGGGCTTGAGGAACTCAACCAAATTTCTTCTCCAAATTTGAGTGTTTATGTGATGGTTCTACTAAAAGGGGCTTCTTTGAAGGACCAAAATGCAAACACCAACATGGTTGAAGGAGGCCAAAATCCTTCATGGAATTATACGGTCAAGTTTGTCATTGATACAAGTAAGCAAATTCAAGCTCTAAAATCTCAACTTATGTTCACTATCATATCCAAAAACAATTAG ATGAGTTACTTTATTCTAGAAATGAATGTCATTTGTGTGGAAGGGCTTGAGGAACTCAACCAAATTTCTTCTCCAAATTTGAGTGTTTATGTGATGGTTCTACTAAAAGGGGCTTCTTTGAAGGACCAAAATGCAAACACCAACATGGTTGAAGGAGGCCAAAATCCTTCATGGAATTATACGGTCAAGTTTGTCATTGATACAAGTAAGCAAATTCAAGCTCTAAAATCTCAACTTATGTTCACTATCATATCCAAAAACAATTAG ATGAGTTACTTTATTCTAGAAATGAATGTCATTTGTGTGGAAGGGCTTGAGGAACTCAACCAAATTTCTTCTCCAAATTTGAGTGTTTATGTGATGGTTCTACTAAAAGGGGCTTCTTTGAAGGACCAAAATGCAAACACCAACATGGTTGAAGGAGGCCAAAATCCTTCATGGAATTATACGGTCAAGTTTGTCATTGATACAAGTAAGCAAATTCAAGCTCTAAAATCTCAACTTATGTTCACTATCATATCCAAAAACAATTAG MSYFILEMNVICVEGLEELNQISSPNLSVYVMVLLKGASLKDQNANTNMVEGGQNPSWNYTVKFVIDTSKQIQALKSQLMFTIISKNN
BLAST of CsaV3_6G017250 vs. NCBI nr
Match: KGN47186.1 (hypothetical protein Csa_6G194700 [Cucumis sativus]) HSP 1 Score: 174.5 bits (441), Expect = 1.6e-40 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. NCBI nr
Match: XP_008458456.1 (PREDICTED: uncharacterized protein LOC103497858 [Cucumis melo]) HSP 1 Score: 138.7 bits (348), Expect = 9.9e-30 Identity = 73/88 (82.95%), Postives = 78/88 (88.64%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. NCBI nr
Match: KGN47184.1 (hypothetical protein Csa_6G194680 [Cucumis sativus]) HSP 1 Score: 63.2 bits (152), Expect = 5.3e-07 Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. NCBI nr
Match: XP_008458457.1 (PREDICTED: protein SRC2-like isoform X1 [Cucumis melo]) HSP 1 Score: 60.8 bits (146), Expect = 2.6e-06 Identity = 35/87 (40.23%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. NCBI nr
Match: XP_008458458.1 (PREDICTED: uncharacterized protein LOC103497859 isoform X2 [Cucumis melo]) HSP 1 Score: 60.8 bits (146), Expect = 2.6e-06 Identity = 35/87 (40.23%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. TAIR10
Match: AT4G15755.1 (Calcium-dependent lipid-binding (CaLB domain) family protein) HSP 1 Score: 43.1 bits (100), Expect = 1.0e-04 Identity = 28/88 (31.82%), Postives = 46/88 (52.27%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. Swiss-Prot
Match: sp|O04133|SRC2_SOYBN (Protein SRC2 OS=Glycine max OX=3847 GN=SRC2 PE=2 SV=1) HSP 1 Score: 49.7 bits (117), Expect = 2.0e-05 Identity = 27/70 (38.57%), Postives = 40/70 (57.14%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. TrEMBL
Match: tr|A0A0A0KHD7|A0A0A0KHD7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194700 PE=4 SV=1) HSP 1 Score: 174.5 bits (441), Expect = 1.1e-40 Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. TrEMBL
Match: tr|A0A1S3C7E1|A0A1S3C7E1_CUCME (uncharacterized protein LOC103497858 OS=Cucumis melo OX=3656 GN=LOC103497858 PE=4 SV=1) HSP 1 Score: 138.7 bits (348), Expect = 6.6e-30 Identity = 73/88 (82.95%), Postives = 78/88 (88.64%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. TrEMBL
Match: tr|A0A0A0KEB7|A0A0A0KEB7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194680 PE=4 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 3.5e-07 Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. TrEMBL
Match: tr|A0A1S3C7W3|A0A1S3C7W3_CUCME (uncharacterized protein LOC103497859 isoform X2 OS=Cucumis melo OX=3656 GN=LOC103497859 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.7e-06 Identity = 35/87 (40.23%), Postives = 53/87 (60.92%), Query Frame = 0
BLAST of CsaV3_6G017250 vs. TrEMBL
Match: tr|A0A1S3C803|A0A1S3C803_CUCME (protein SRC2-like isoform X1 OS=Cucumis melo OX=3656 GN=LOC103497859 PE=4 SV=1) HSP 1 Score: 60.8 bits (146), Expect = 1.7e-06 Identity = 35/87 (40.23%), Postives = 53/87 (60.92%), Query Frame = 0
The following BLAST results are available for this feature:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |