CsaV3_5G014830 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: CDSexonpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.AAAAGATGGCAAGGCTGAGGTTTTGAAGGAACAACCGAAATTCGATGATGAAAAGCTTAAAGCAATTTTCACTGTGATAGAAGGAGATGTGGTAAAGAAATATAAAAGCTTCAAGATCACTCATCATCCGGTACCGAAGAGTCCTCAACAATGTGTGGTTTACATAACTATAGAATATGAAAAATATGATTCTACCACACCCGATCCATACAATTACCTTCAATTAATTGGCAAAGCTTTTAAGGATGTGGAAGCCCATCTTATTCATGATTAG AAAGATGGCAAGGCTGAGGTTTTGAAGGAACAACCGAAATTCGATGATGAAAAGCTTAAAGCAATTTTCACTGTGATAGAAGGAGATGTGGTAAAGAAATATAAAAGCTTCAAGATCACTCATCATCCGGTACCGAAGAGTCCTCAACAATGTGTGGTTTACATAACTATAGAATATGAAAAATATGATTCTACCACACCCGATCCATACAATTACCTTCAATTAATTGGCAAAGCTTTTAAGGATGTGGAAGCCCATCTTATTCATGATTA AAAGATGGCAAGGCTGAGGTTTTGAAGGAACAACCGAAATTCGATGATGAAAAGCTTAAAGCAATTTTCACTGTGATAGAAGGAGATGTGGTAAAGAAATATAAAAGCTTCAAGATCACTCATCATCCGGTACCGAAGAGTCCTCAACAATGTGTGGTTTACATAACTATAGAATATGAAAAATATGATTCTACCACACCCGATCCATACAATTACCTTCAATTAATTGGCAAAGCTTTTAAGGATGTGGAAGCCCATCTTATTCATGATTA KDGKAEVLKEQPKFDDEKLKAIFTVIEGDVVKKYKSFKITHHPVPKSPQQCVVYITIEYEKYDSTTPDPYNYLQLIGKAFKDVEAHLIHDX
BLAST of CsaV3_5G014830 vs. NCBI nr
Match: XP_011654478.1 (PREDICTED: MLP-like protein 328 [Cucumis sativus]) HSP 1 Score: 150.2 bits (378), Expect = 3.4e-33 Identity = 70/88 (79.55%), Postives = 75/88 (85.23%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. NCBI nr
Match: XP_004142278.2 (PREDICTED: MLP-like protein 329 [Cucumis sativus] >KGN49635.1 hypothetical protein Csa_5G034375 [Cucumis sativus]) HSP 1 Score: 144.1 bits (362), Expect = 2.4e-31 Identity = 65/88 (73.86%), Postives = 77/88 (87.50%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. NCBI nr
Match: XP_008450256.1 (PREDICTED: MLP-like protein 329 [Cucumis melo]) HSP 1 Score: 141.0 bits (354), Expect = 2.0e-30 Identity = 66/89 (74.16%), Postives = 75/89 (84.27%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. NCBI nr
Match: XP_008450257.1 (PREDICTED: MLP-like protein 329 [Cucumis melo]) HSP 1 Score: 140.6 bits (353), Expect = 2.7e-30 Identity = 67/89 (75.28%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. NCBI nr
Match: XP_022942349.1 (MLP-like protein 328 [Cucurbita moschata]) HSP 1 Score: 95.9 bits (237), Expect = 7.5e-17 Identity = 45/86 (52.33%), Postives = 58/86 (67.44%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TAIR10
Match: AT1G14940.1 (Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 74.3 bits (181), Expect = 4.3e-14 Identity = 31/88 (35.23%), Postives = 56/88 (63.64%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TAIR10
Match: AT1G14930.1 (Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 73.9 bits (180), Expect = 5.6e-14 Identity = 31/87 (35.63%), Postives = 56/87 (64.37%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TAIR10
Match: AT1G23120.1 (Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 70.9 bits (172), Expect = 4.7e-13 Identity = 35/89 (39.33%), Postives = 50/89 (56.18%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TAIR10
Match: AT4G14060.1 (Polyketide cyclase/dehydrase and lipid transport superfamily protein) HSP 1 Score: 63.9 bits (154), Expect = 5.8e-11 Identity = 30/87 (34.48%), Postives = 51/87 (58.62%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TAIR10
Match: AT2G01520.1 (MLP-like protein 328) HSP 1 Score: 62.8 bits (151), Expect = 1.3e-10 Identity = 28/87 (32.18%), Postives = 50/87 (57.47%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. Swiss-Prot
Match: sp|Q9ZVF3|ML328_ARATH (MLP-like protein 328 OS=Arabidopsis thaliana OX=3702 GN=MLP328 PE=2 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.3e-09 Identity = 28/87 (32.18%), Postives = 50/87 (57.47%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. Swiss-Prot
Match: sp|Q9ZVF2|ML329_ARATH (MLP-like protein 329 OS=Arabidopsis thaliana OX=3702 GN=MLP329 PE=2 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 3.9e-09 Identity = 29/87 (33.33%), Postives = 50/87 (57.47%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. Swiss-Prot
Match: sp|Q941R6|MLP31_ARATH (MLP-like protein 31 OS=Arabidopsis thaliana OX=3702 GN=MLP31 PE=2 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 2.6e-08 Identity = 35/91 (38.46%), Postives = 52/91 (57.14%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. Swiss-Prot
Match: sp|Q9SSK7|MLP34_ARATH (MLP-like protein 34 OS=Arabidopsis thaliana OX=3702 GN=MLP34 PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 9.7e-08 Identity = 36/89 (40.45%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. Swiss-Prot
Match: sp|Q9SSK9|MLP28_ARATH (MLP-like protein 28 OS=Arabidopsis thaliana OX=3702 GN=MLP28 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.4e-06 Identity = 32/89 (35.96%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TrEMBL
Match: tr|A0A0A0KIT9|A0A0A0KIT9_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G034375 PE=4 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 1.6e-31 Identity = 65/88 (73.86%), Postives = 77/88 (87.50%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TrEMBL
Match: tr|A0A1S3BNV8|A0A1S3BNV8_CUCME (MLP-like protein 329 OS=Cucumis melo OX=3656 GN=LOC103491918 PE=4 SV=1) HSP 1 Score: 141.0 bits (354), Expect = 1.4e-30 Identity = 66/89 (74.16%), Postives = 75/89 (84.27%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TrEMBL
Match: tr|A0A1S3BNT9|A0A1S3BNT9_CUCME (MLP-like protein 329 OS=Cucumis melo OX=3656 GN=LOC103491919 PE=4 SV=1) HSP 1 Score: 140.6 bits (353), Expect = 1.8e-30 Identity = 67/89 (75.28%), Postives = 73/89 (82.02%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TrEMBL
Match: tr|A0A1S3BPF9|A0A1S3BPF9_CUCME (MLP-like protein 328 OS=Cucumis melo OX=3656 GN=LOC103491905 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 2.5e-16 Identity = 44/85 (51.76%), Postives = 56/85 (65.88%), Query Frame = 0
BLAST of CsaV3_5G014830 vs. TrEMBL
Match: tr|A0A0A0KIU7|A0A0A0KIU7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G040500 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 2.5e-16 Identity = 44/85 (51.76%), Postives = 56/85 (65.88%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|