CsaV3_5G014820 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATAAAATAAAAATAAAATAATTAAAAAATTGTATAATGAGCAATCCAAAGATAAAAAAAAAATTAAAACAGAAAAAGAAGTAATAATTGGAGGTGGGTTGGGAATGGTAGTATAAATATGAACCTCTGTTGTTTGGATAGGAGAGGCACTTACTAATTACCCATATTTCATAAGTTTGTGTGTATTTCTAGTAAGCAAGGAAATTGAAATGTCGGATTATACTCCAGTTCAGGATCTTGATAATCCACACATAAAAGAATTAGCAGAATGGACGGTAGCAGAGTACAACAAAGAAGGAGGATATCAATTGGCATTGAGTAGTGTGGTCAAGTGCGAGTCGCAGATTGTGGCCGGAGTCAACTACCGTTTTATCTTAACGGCTAAGGATGAAAACGATAATGAGGGAAACTATGAAGCTGTTATCTGGGAGAAAGTATGGGACCAATTCCGTAAACTCATTTCCTTCCAACCTCTCTTGACATGATGAACAGAATCAAGCTCATGCCTATATTTATATGTTCAATAAAACTATCTCACTTAATTGCCACTTACAAAACATAAAGTTGAGTCAGTTAAGTTTGAAATAATTGTATGTGTTTGGGTGTGTACTTGAGTTGCTCTCATTTAGTTAACAAGTTTGTGGAGTGCAGAGTCTATGTGTTATAATTGAGTTAATTAATAATATTTTATGCATTTTCGTTTTCCATTAAAAAAA ATGTCGGATTATACTCCAGTTCAGGATCTTGATAATCCACACATAAAAGAATTAGCAGAATGGACGGTAGCAGAGTACAACAAAGAAGGAGGATATCAATTGGCATTGAGTAGTGTGGTCAAGTGCGAGTCGCAGATTGTGGCCGGAGTCAACTACCGTTTTATCTTAACGGCTAAGGATGAAAACGATAATGAGGGAAACTATGAAGCTGTTATCTGGGAGAAAGTATGGGACCAATTCCGTAAACTCATTTCCTTCCAACCTCTCTTGACATGA ATGTCGGATTATACTCCAGTTCAGGATCTTGATAATCCACACATAAAAGAATTAGCAGAATGGACGGTAGCAGAGTACAACAAAGAAGGAGGATATCAATTGGCATTGAGTAGTGTGGTCAAGTGCGAGTCGCAGATTGTGGCCGGAGTCAACTACCGTTTTATCTTAACGGCTAAGGATGAAAACGATAATGAGGGAAACTATGAAGCTGTTATCTGGGAGAAAGTATGGGACCAATTCCGTAAACTCATTTCCTTCCAACCTCTCTTGACATGA MSDYTPVQDLDNPHIKELAEWTVAEYNKEGGYQLALSSVVKCESQIVAGVNYRFILTAKDENDNEGNYEAVIWEKVWDQFRKLISFQPLLT
BLAST of CsaV3_5G014820 vs. NCBI nr
Match: NP_001267677.1 (cysteine proteinase inhibitor 5-like [Cucumis sativus] >BAA28867.1 cystein proteinase inhibitor [Cucumis sativus]) HSP 1 Score: 129.8 bits (325), Expect = 4.8e-27 Identity = 53/88 (60.23%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. NCBI nr
Match: XP_008441065.1 (PREDICTED: cysteine proteinase inhibitor 5-like [Cucumis melo]) HSP 1 Score: 125.2 bits (313), Expect = 1.2e-25 Identity = 54/87 (62.07%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. NCBI nr
Match: KGN48342.1 (hypothetical protein Csa_6G483248 [Cucumis sativus]) HSP 1 Score: 119.8 bits (299), Expect = 4.9e-24 Identity = 53/87 (60.92%), Postives = 65/87 (74.71%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. NCBI nr
Match: KGN48340.1 (hypothetical protein Csa_6G483245 [Cucumis sativus]) HSP 1 Score: 106.7 bits (265), Expect = 4.3e-20 Identity = 50/89 (56.18%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. NCBI nr
Match: XP_016196438.1 (cysteine proteinase inhibitor 1-like [Arachis ipaensis] >XP_025644812.1 cysteine proteinase inhibitor 1-like [Arachis hypogaea]) HSP 1 Score: 105.1 bits (261), Expect = 1.3e-19 Identity = 49/87 (56.32%), Postives = 63/87 (72.41%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 79.7 bits (195), Expect = 1.0e-15 Identity = 33/85 (38.82%), Postives = 54/85 (63.53%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 63.2 bits (152), Expect = 9.9e-11 Identity = 29/84 (34.52%), Postives = 50/84 (59.52%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TAIR10
Match: AT2G40880.1 (cystatin A) HSP 1 Score: 58.2 bits (139), Expect = 3.2e-09 Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. Swiss-Prot
Match: sp|Q6TPK4|CYT1_ACTDE (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 8.3e-15 Identity = 35/84 (41.67%), Postives = 58/84 (69.05%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. Swiss-Prot
Match: sp|Q41916|CYT5_ARATH (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 79.7 bits (195), Expect = 1.8e-14 Identity = 33/85 (38.82%), Postives = 54/85 (63.53%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. Swiss-Prot
Match: sp|Q10Q46|CYT6_ORYSJ (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.9e-11 Identity = 34/85 (40.00%), Postives = 52/85 (61.18%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. Swiss-Prot
Match: sp|Q10J94|CYT8_ORYSJ (Cysteine proteinase inhibitor 8 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0429000 PE=2 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.9e-11 Identity = 30/85 (35.29%), Postives = 49/85 (57.65%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. Swiss-Prot
Match: sp|Q10Q47|CYT7_ORYSJ (Putative cysteine proteinase inhibitor 7 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210100 PE=3 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.5e-11 Identity = 38/93 (40.86%), Postives = 55/93 (59.14%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TrEMBL
Match: tr|O80389|O80389_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 3.1e-27 Identity = 53/88 (60.23%), Postives = 71/88 (80.68%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TrEMBL
Match: tr|A0A1S3B2L7|A0A1S3B2L7_CUCME (Cysteine proteinase inhibitor OS=Cucumis melo OX=3656 GN=LOC103485290 PE=3 SV=1) HSP 1 Score: 125.2 bits (313), Expect = 7.8e-26 Identity = 54/87 (62.07%), Postives = 68/87 (78.16%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TrEMBL
Match: tr|A0A0A0KIY5|A0A0A0KIY5_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G483248 PE=3 SV=1) HSP 1 Score: 119.8 bits (299), Expect = 3.3e-24 Identity = 53/87 (60.92%), Postives = 65/87 (74.71%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TrEMBL
Match: tr|A0A0A0KF46|A0A0A0KF46_CUCSA (Cysteine proteinase inhibitor OS=Cucumis sativus OX=3659 GN=Csa_6G483245 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 2.9e-20 Identity = 50/89 (56.18%), Postives = 68/89 (76.40%), Query Frame = 0
BLAST of CsaV3_5G014820 vs. TrEMBL
Match: tr|A0A1S3UQH7|A0A1S3UQH7_VIGRR (Cysteine proteinase inhibitor OS=Vigna radiata var. radiata OX=3916 GN=LOC106767830 PE=3 SV=1) HSP 1 Score: 103.2 bits (256), Expect = 3.2e-19 Identity = 42/86 (48.84%), Postives = 64/86 (74.42%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|