CsaV3_5G013330 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: exonpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.CTATTATTCTTCAACAAATACATTCAAACCCAAATTCACATTCCTCAACTTCAATCAAAAAACAATGGCTGATATTTGTCCTCCTGGTATTGTTTCCATTTATGATTTTACATTACAACAAGTTTTAAAACACTCTATATACATTTTATACAGTGTTCGTGAGCTTTCTAATTCAACGTTCGCAATTGGGGTTAGATTTTTTGTAATCGAATACCCATTTGAAGCATTAAGAAAAAATATGAAGTTATTGTCTCTCAAAACCGATTTGGAACGAGTGGAACAACATTTATGTCTTTGATTACTGCTATGAAGATTTATTTGTACCACTTATTTCCTTTTTGGCTTCTTCATGATTATGGAATACTTCTGTTTGATGATCTTTAGGCTGTAGTTTTGTTTGAATATTTTTCCATTATATCTCTTCGGATATTTCATATTGTGATGATTAAATTTGGTTATTTGTTTTGGTATATAATTATGATCAGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAAGGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTCGTTAATATACACGACCTGGTTGTTGAAGTTCCAAAGGTTGGTTAA ATGGCTGATATTTGTCCTCCTGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAAGGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTCGTTAATATACACGACCTGGTTGTTGAAGTTCCAAAGGTTGGTTAA ATGGCTGATATTTGTCCTCCTGGAAAAAATCAGTGGCCAGAACTTGTTGGAGTAAAAGCAACAACTGCAAAGTATATCATCAAGAAGGACAACCCTAACGTAGAAAATGTTGTAGTTCTCTTGGCTGGAAGTGGAACCACGGAAGATATTAGGTGTGATCGAGTTTGGGTGTTCGTTAATATACACGACCTGGTTGTTGAAGTTCCAAAGGTTGGTTAA MADICPPGKNQWPELVGVKATTAKYIIKKDNPNVENVVVLLAGSGTTEDIRCDRVWVFVNIHDLVVEVPKVG
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: KGN50840.1 (hypothetical protein Csa_5G286040 [Cucumis sativus]) HSP 1 Score: 155.6 bits (392), Expect = 6.4e-35 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: ALD47589.1 (serine proteinase inhibitor [Cucumis metulifer]) HSP 1 Score: 136.7 bits (343), Expect = 3.1e-29 Identity = 59/72 (81.94%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: KGN50838.1 (hypothetical protein Csa_5G285030 [Cucumis sativus]) HSP 1 Score: 121.7 bits (304), Expect = 1.0e-24 Identity = 55/72 (76.39%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: XP_022963567.1 (inhibitor of trypsin and hageman factor-like [Cucurbita moschata]) HSP 1 Score: 87.0 bits (214), Expect = 2.8e-14 Identity = 39/74 (52.70%), Postives = 54/74 (72.97%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. NCBI nr
Match: KDP36377.1 (hypothetical protein JCGZ_08646 [Jatropha curcas]) HSP 1 Score: 86.3 bits (212), Expect = 4.8e-14 Identity = 39/69 (56.52%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR10
Match: AT2G38870.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 68.9 bits (167), Expect = 1.4e-12 Identity = 33/66 (50.00%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR10
Match: AT5G43580.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 67.8 bits (164), Expect = 3.2e-12 Identity = 32/73 (43.84%), Postives = 49/73 (67.12%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR10
Match: AT2G38900.2 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 55.5 bits (132), Expect = 1.6e-08 Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR10
Match: AT3G46860.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 53.9 bits (128), Expect = 4.8e-08 Identity = 27/71 (38.03%), Postives = 41/71 (57.75%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TAIR10
Match: AT3G50020.1 (Serine protease inhibitor, potato inhibitor I-type family protein) HSP 1 Score: 39.7 bits (91), Expect = 9.3e-04 Identity = 25/59 (42.37%), Postives = 33/59 (55.93%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. Swiss-Prot
Match: sp|P20076|IER1_SOLLC (Ethylene-responsive proteinase inhibitor 1 OS=Solanum lycopersicum OX=4081 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 3.9e-15 Identity = 37/64 (57.81%), Postives = 47/64 (73.44%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. Swiss-Prot
Match: sp|P16231|ICI1_SOLPE (Wound-induced proteinase inhibitor 1 OS=Solanum peruvianum OX=4082 PE=3 SV=1) HSP 1 Score: 79.0 bits (193), Expect = 2.5e-14 Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. Swiss-Prot
Match: sp|Q02214|ITR1_NICSY (Trypsin inhibitor 1 OS=Nicotiana sylvestris OX=4096 PE=2 SV=1) HSP 1 Score: 76.6 bits (187), Expect = 1.2e-13 Identity = 35/69 (50.72%), Postives = 49/69 (71.01%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. Swiss-Prot
Match: sp|Q03199|IPIB_TOBAC (Proteinase inhibitor I-B OS=Nicotiana tabacum OX=4097 GN=TIMPA PE=2 SV=1) HSP 1 Score: 75.5 bits (184), Expect = 2.8e-13 Identity = 33/64 (51.56%), Postives = 46/64 (71.88%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. Swiss-Prot
Match: sp|Q03198|IPIA_TOBAC (Proteinase inhibitor I-A OS=Nicotiana tabacum OX=4097 GN=TIMPB PE=2 SV=1) HSP 1 Score: 74.7 bits (182), Expect = 4.7e-13 Identity = 31/64 (48.44%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TrEMBL
Match: tr|A0A0A0KME7|A0A0A0KME7_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G286040 PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 4.3e-35 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TrEMBL
Match: tr|A0A0M3SAG8|A0A0M3SAG8_9ROSI (Serine proteinase inhibitor OS=Cucumis metulifer OX=61886 PE=2 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 2.0e-29 Identity = 59/72 (81.94%), Postives = 69/72 (95.83%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TrEMBL
Match: tr|A0A0A0KMM0|A0A0A0KMM0_CUCSA (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G285030 PE=4 SV=1) HSP 1 Score: 121.7 bits (304), Expect = 6.8e-25 Identity = 55/72 (76.39%), Postives = 62/72 (86.11%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TrEMBL
Match: tr|A0A067KJS6|A0A067KJS6_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_08646 PE=4 SV=1) HSP 1 Score: 86.3 bits (212), Expect = 3.2e-14 Identity = 39/69 (56.52%), Postives = 50/69 (72.46%), Query Frame = 0
BLAST of CsaV3_5G013330 vs. TrEMBL
Match: tr|A0A067KGK1|A0A067KGK1_JATCU (Uncharacterized protein OS=Jatropha curcas OX=180498 GN=JCGZ_10340 PE=4 SV=1) HSP 1 Score: 85.9 bits (211), Expect = 4.1e-14 Identity = 39/69 (56.52%), Postives = 49/69 (71.01%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene:
The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene:
|