CsaV3_5G012930 (gene) Cucumber (Chinese Long) v3
The following sequences are available for this feature:
Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.ATGAGTTGTGTACAAGTACTTCCAAATACTCATGACCTGATTAAGGATGTCCATAGCCCAAACGTGATAGAAGCTGGAAAGATAGCAGTGGATGAACATAACAAGAAAGAAAATGACAATTTAGTTTTCACTCGTGTAGTGAGTGGTTTAGCACCCCGTGCTATTATTGGAACTATATTATGGTCATATATTCTCGTGATAGAAGCTAAAAACTGCGACGGATATCCTGTGGCATATGTGGCTAAAATAGTTAAGTATCTTACAATTCCAGAAAATAGCTATGAACTTGTCAGCTTTCAAGCTATACTCGGGTATAAGTAG ATGAGTTGTGTACAAGTACTTCCAAATACTCATGACCTGATTAAGGATGTCCATAGCCCAAACGTGATAGAAGCTGGAAAGATAGCAGTGGATGAACATAACAAGAAAGAAAATGACAATTTAGTTTTCACTCGTGTAGTGAGTGGTTTAGCACCCCGTGCTATTATTGGAACTATATTATGGTCATATATTCTCGTGATAGAAGCTAAAAACTGCGACGGATATCCTGTGGCATATGTGGCTAAAATAGTTAAGTATCTTACAATTCCAGAAAATAGCTATGAACTTGTCAGCTTTCAAGCTATACTCGGGTATAAGTAG ATGAGTTGTGTACAAGTACTTCCAAATACTCATGACCTGATTAAGGATGTCCATAGCCCAAACGTGATAGAAGCTGGAAAGATAGCAGTGGATGAACATAACAAGAAAGAAAATGACAATTTAGTTTTCACTCGTGTAGTGAGTGGTTTAGCACCCCGTGCTATTATTGGAACTATATTATGGTCATATATTCTCGTGATAGAAGCTAAAAACTGCGACGGATATCCTGTGGCATATGTGGCTAAAATAGTTAAGTATCTTACAATTCCAGAAAATAGCTATGAACTTGTCAGCTTTCAAGCTATACTCGGGTATAAGTAG MSCVQVLPNTHDLIKDVHSPNVIEAGKIAVDEHNKKENDNLVFTRVVSGLAPRAIIGTILWSYILVIEAKNCDGYPVAYVAKIVKYLTIPENSYELVSFQAILGYK
BLAST of CsaV3_5G012930 vs. NCBI nr
Match: XP_010434812.1 (PREDICTED: cysteine proteinase inhibitor 4-like [Camelina sativa]) HSP 1 Score: 59.3 bits (142), Expect = 9.2e-06 Identity = 36/89 (40.45%), Postives = 51/89 (57.30%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. NCBI nr
Match: XP_010449778.1 (PREDICTED: cysteine proteinase inhibitor 4-like [Camelina sativa]) HSP 1 Score: 58.9 bits (141), Expect = 1.2e-05 Identity = 37/89 (41.57%), Postives = 50/89 (56.18%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. NCBI nr
Match: XP_018469246.1 (PREDICTED: cysteine proteinase inhibitor 4-like [Raphanus sativus]) HSP 1 Score: 58.5 bits (140), Expect = 1.6e-05 Identity = 32/72 (44.44%), Postives = 44/72 (61.11%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. NCBI nr
Match: CDP21698.1 (unnamed protein product [Coffea canephora]) HSP 1 Score: 56.2 bits (134), Expect = 7.8e-05 Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. NCBI nr
Match: XP_010440147.1 (PREDICTED: cysteine proteinase inhibitor 4-like [Camelina sativa]) HSP 1 Score: 56.2 bits (134), Expect = 7.8e-05 Identity = 36/89 (40.45%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. TAIR10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 52.4 bits (124), Expect = 2.0e-07 Identity = 34/89 (38.20%), Postives = 50/89 (56.18%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. TAIR10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein) HSP 1 Score: 42.4 bits (98), Expect = 2.1e-04 Identity = 26/68 (38.24%), Postives = 37/68 (54.41%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. Swiss-Prot
Match: sp|Q84WT8|CYT4_ARATH (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 52.4 bits (124), Expect = 3.7e-06 Identity = 34/89 (38.20%), Postives = 50/89 (56.18%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. TrEMBL
Match: tr|A0A068VPR8|A0A068VPR8_COFCA (Cysteine proteinase inhibitor OS=Coffea canephora OX=49390 GN=GSCOC_T00008667001 PE=3 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 5.1e-05 Identity = 29/64 (45.31%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. TrEMBL
Match: tr|R0GZD4|R0GZD4_9BRAS (Cysteine proteinase inhibitor OS=Capsella rubella OX=81985 GN=CARUB_v10006049mg PE=3 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 2.0e-04 Identity = 35/89 (39.33%), Postives = 52/89 (58.43%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. TrEMBL
Match: tr|V4MRH3|V4MRH3_EUTSA (Cysteine proteinase inhibitor OS=Eutrema salsugineum OX=72664 GN=EUTSA_v10026611mg PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 2.6e-04 Identity = 37/89 (41.57%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. TrEMBL
Match: tr|A0A0D6QZP0|A0A0D6QZP0_ARACU (Cysteine proteinase inhibitor OS=Araucaria cunninghamii OX=56994 PE=3 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 2.6e-04 Identity = 29/66 (43.94%), Postives = 41/66 (62.12%), Query Frame = 0
BLAST of CsaV3_5G012930 vs. TrEMBL
Match: tr|D7M9U3|D7M9U3_ARALL (Cysteine proteinase inhibitor OS=Arabidopsis lyrata subsp. lyrata OX=81972 GN=ARALYDRAFT_493227 PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 4.4e-04 Identity = 36/92 (39.13%), Postives = 52/92 (56.52%), Query Frame = 0
The following BLAST results are available for this feature:
The following terms have been associated with this gene:
GO Assignments
This gene is annotated with the following GO terms.
The following mRNA feature(s) are a part of this gene:
Analysis Name: InterPro Annotations of cucumber chineselong genome (v3)
Date Performed: 2019-03-04
The following gene(s) are orthologous to this gene: None The following gene(s) are paralogous to this gene: None The following block(s) are covering this gene: |